9-Letter Words Containing: D,E,H,S,S
(In Any Order)
There are 177 9 letter words,
8 9 letter phrases and
0 9 letter abbr's with
D,E,H,S,S in.
Best Scoring
Expand? | Word | Save? | Length | Usage | Points | Type | ||
---|---|---|---|---|---|---|---|---|
squooshed | 9 | 22 | verbv | |||||
Valid word for Scrabble US
| ||||||||
hashheads | 9 | 19 | nounn | |||||
Valid word for Scrabble US
| ||||||||
sheikdoms | 9 | 19 | nounn | |||||
noun • the domain ruled by a sheik | ||||||||
shelducks | 9 | 19 | noun, adjectiven, adj | |||||
noun • female sheldrake | ||||||||
milksheds | 9 | 19 | nounn | |||||
Valid word for Scrabble US
| ||||||||
beshadows | 9 | 18 | ||||||
Valid word for Scrabble US
| ||||||||
showcased | 9 | 18 | verbv | |||||
noun • a setting in which something can be displayed to best effect • a glass container used to store and display items in a shop or museum or home | ||||||||
shepherds | 9 | 18 | verb, nounv, n | |||||
noun • a clergyman who watches over a group of people • a herder of sheep (on an open range); someone who keeps the sheep together in a flock verb • watch over like a shepherd, as a teacher of her pupils • tend as a shepherd, as of sheep or goats | ||||||||
kiddushes | 9 | 18 | verb, nounv, n | |||||
noun • A blessing recited over wine or grape juice in commemoration of the sanctity of the Shabbat or other Jewish holy day. | ||||||||
spadefish | 9 | 18 | nounn | |||||
noun • deep-bodied disk-shaped food fish of warmer western Atlantic coastal waters | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
All 9 Letter Words
Words (177)
dishonestskinheadschildlessharnessedheaddresschastisedduchessesdeathlessshadelesscrossheadhumidnessenshroudsrhapsodesschedulesbeshadowsshowcasedadhesivesbeshroudssoreheadsheadrestsshepherdshillsidesdisrelishdiathesisshrewdesthandpressbedsheetssquooshedsulphideshedonismshedonistsshoresidehogsheadsshieldersdishevelshardnosessunshadesspiderishhorseshodeyeshadessnowshoedschmoosedshadflieskiddushesshoddieststudhorsesoftheadscoalshedsmisshapedhostessedhandinessmadhousesredfishesadhesionsredhorsessideshowshardinessswanherdssphenoidsspadefishdroshkiesbethesdasditheismsheadsailsstonishedditheistsheadinessheadshipstoolshedsshipsidesdustheapskaddishesheadstaysbushveldsspheroidsshreddershardassesselfhoodsshrewdiesshetlandsdogeshipsfeldshersdervishesserfhoodsdogfishespotsherdshydropsessandshoestundishesdosshousedepthlesswoodshedsdisheritsdiaphysesasphodelssheepdogsdoghouseshashheadschorussedkeeshondshempseedsdishwaressnowshedscodfishessheikdomsunwashedsshadinessshelducksmilkshedschresardsshadowersredshanksshouldersmudfishesshouldestmastheadsredshiftsdiathesesredshirtswoolshedssidehillsdeanshipssidepathsslapheadsbardashesdemyshipssideshootduchessedbudmashesseldshownditchlessburdashesschiedamsmedressehheadshotssheadingsstemheadsdustsheetsandheapsshredlessdayshellsberdashesdysthesiadisthenesdishablesseahoundssplooshedhandsomessheddingsshedloadsdeishealsdobhashesheedinesschildnessdrisheensshandriesdespightshesperidsdeschoolsdishorseddishorsesdukeshipsdishouseddishousesjehadismsjehadistsherdessesdogshoresbadmasheshelpdeskssylphidespiedishesdisshiverheadcasesrhabdusesenshieldsheadfastsPhrases (8)
disk shapedust sheetdress shippush asideodd hasselsouth sideside horsedress shop