Dictionary Only:
Profanity Off:

9-Letter Words Containing: ANG

 (In Exact Order)
There are 285 9 letter words, 40 9 letter phrases and 0 9 letter abbr's with ANG in.

Best Scoring

Expand?WordSave?LengthUsagePointsType
whizzbang9
36 nounn
noun

• a small high-velocity shell; it makes a whizzing sound followed by a bang when it hits

• a firecracker that (like the whizbang shell) makes a whizzing sound followed by a loud explosion

zugzwangs9
32 nounn
Valid word for Scrabble US
whizbangs9
27 nounn
noun

• a small high-velocity shell; it makes a whizzing sound followed by a bang when it hits

• a firecracker that (like the whizbang shell) makes a whizzing sound followed by a loud explosion

exchanged9
23 verbv
adjective satellite

• changed for (replaced by) something different

mbaqangas9
23 nounn
Valid word for Scrabble US
exchanger9
22 nounn
noun

• one whose business is to exchange the money of one country for that of another country

exchanges9
22 verb, noun, adjectivev, n, adj
noun

• chemical process in which one atom or ion or group changes places with another

• a mutual expression of views (especially an unpleasant one)

• the act of changing one thing for another thing

• the act of giving something in return for something received

• a workplace that serves as a telecommunications facility where lines from telephones can be connected together to permit communication

• a workplace for buying and selling; open only to members

• (sports) an unbroken sequence of several successive strokes

• reciprocal transfer of equivalent sums of money (especially the currencies of different countries)

• the act of putting one thing or person in the place of another:

• (chess) gaining (or losing) a rook in return for a knight or bishop

• (chess) the capture by both players (usually on consecutive moves) of pieces of equal value

verb

• give to, and receive from, one another

• exchange or replace with another, usually of the same kind or category

• change over, change around, as to a new order or sequence

• hand over one and receive another, approximately equivalent

• put in the place of another; switch seemingly equivalent items

• exchange a penalty for a less severe one

anglicize9
21 verbv
verb

• make English in appearance

quandangs9
20 nounn
noun

• Australian tree with edible flesh and edible nutlike seed

• red Australian fruit; used for dessert or in jam

changeful9
18 adjectiveadj
adjective

• such that alteration is possible; having a marked tendency to change

or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 9 Letter Words With ANG In Order

Words (285)
dangerousstrangelystrangledexchangedstrangestbangalorearrangingpyongyangrearrangeunchangedentangledstranglertangerineangeliquearchangelguangzhouestrangedboomerangorangutanguangdongstranglesanguishedrectanglewranglingmanganesestavangerfrangibledownrangeangiogramrangatiraangulatedharanguedphalangeshydrangeaangelfishgangplankpentanglerangelandembrangleuntangledangrinessorangeadetanginessanglewormfalangistexchangerlanguidlyfandangleangelicallangoustechangefulangliciseomnirangeplangencybespanglefirefangsorangerietriangledganglandsuntanglesangulatesgangstersharanguesexchangesmridangamsangfroidtrianglesanguishesgangrenedarrangersmangabiesmridangasharangueroutrangedspanglingvanguardsentangleshangoverstangiblesslangiestsporangiaestrangerkaoliangsseladangslangridgeoutsprangtwanglerscotangentgangplowslangsynespangolinswhizzbangdoghangedmangabeyslilangenihangnailsstranguryzugzwangsmanganiteangelicasestrangesmangrovesrehangingtangentalcarangoidjangliestorangiestsemianglephalangergangliatelangshanstwanglingdefangingparasangsspanglierranginesshangaringpoontangswhizbangsentanglerhangnestsmangonelsstraphangangelusessaladangsslanguagechangeupsclangoredfranglaislanglaufsshanghaistwangiestangstromsdangeringgangliestoverhangsumangitesangularlyderangersgangreneslanguagesphalangalanglicismhangbirdsmanganinspressgangstrangersangosturamanganatebangtailsrechangedmanginessangerlessmbaqangasanglepodstangolikeoctanglessanguinesclangoursgalangalslangragesoutrangesangiologydangliestganglionsunhangingderanginglanguetteanglicizeendangershangfiresmanganousquandangswranglersrechangestangencesangiomatacarangidsevangelicintergangmidrangessangareestangliestanglesitefandangoskangarooscitrangesangophoracliffhangslangingskuangchouanguipededanglingsspangletsphalangidsprangledwanglingsanglophilred-orangebangsringenrangingmangetoutbostangismerlangusangklungstanglingsorange-redanglewiseanglicistclangingsfontangeskarangaedangiocarpangstiestcontangosovergangsslangulardangaleatkwangchowvanguerialanguageduphangingwide-anglesprangleslong-rangeangashorebangstersrangiorasgangboardmangiferabranglingetrangereheadbangsmangulatetanghininangledugsfalangismjanglingssanglierstangoistscanangiumherpangiaorangemananglifiedlangspelsspanghewsangle-parkkwangtungbangalaysdrangwayswoomerangsang-froidangekkoksmangostansynangiumanguillanshangri-laburrawangetrangersimbranglesalanganecharangasjingbangsnewfanglesanguinedthranginganglifiestwangingschuang-tzukalumpanganguiformlangspielpangamiesspanglersanglewinglangobardgangshagsvendangesbangalowsangraecumfree-rangeangelhoodboomslangmangoustecharangos
Phrases (40)
chain gangpress gangface angleyouth gangsea tangleangel cakehang glidelangue d'ocangry walktilt angleview anglehome rangerange polesea changeguilt panghour angleangle irongang fightgolf rangeslang wordblue angeltest rangeangle viseangora catsan angelosex changeoil changeangel dustchen n. yangjean genetpisang waxrange hoodwild mangocare a hangwave anglelever hanggive a hangmango treeslang termorange bat
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen