9-Letter Words Containing: A,H,L,S,S
(In Any Order)
There are 179 9 letter words,
18 9 letter phrases and
0 9 letter abbr's with
A,H,L,S,S in.
Best Scoring
Expand? | Word | Save? | Length | Usage | Points | Type | ||
---|---|---|---|---|---|---|---|---|
schmalzes | 9 | 25 | nounn | |||||
Valid word for Scrabble US
| ||||||||
squashily | 9 | 24 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
shmaltzes | 9 | 23 | nounn | |||||
Valid word for Scrabble US
| ||||||||
shashlick | 9 | 21 | verb, nounv, n | |||||
Valid word for Scrabble US
| ||||||||
squallish | 9 | 21 | ||||||
Valid word for Scrabble US
| ||||||||
backslash | 9 | 20 | nounn | |||||
noun • The punctuation mark \. • Used erroneously in reference to, or in reading out, the ordinary slash, that is, the punctuation mark /. verb • To escape (a metacharacter) by prepending a backslash that serves as an escape character, thereby forming an escape sequence. | ||||||||
washbowls | 9 | 20 | nounn | |||||
noun • a bathroom sink that is permanently installed and connected to a water supply and drainpipe; where you can wash your hands and face • a basin for washing the hands | ||||||||
waspishly | 9 | 20 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
shashliks | 9 | 19 | nounn | |||||
noun • A form of shish kebab, originally made of marinated lamb meat. | ||||||||
skaldship | 9 | 19 | nounn | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
All 9 Letter Words
Words (179)
establishshamelessheartlesssplashinghourglassfaithlessnewsflashthanklessshapelesschrysalismatchlesshalitosisseneschaldeathlessaeschylusflashiestbackslashcharmlessslavishlyalmshouseshadelessshashlickshoelacesshashlikslithiaseseschewalsskaldshipphysicalslavishestbushlandsthalassicloathnessflagshipsshoptalkswheatlessplanishesalehousesshacklersabolishesshadblowsthallusesnathelessshadfliesseashellsholdfastshaplesslyeschalotshalitoseshalitusescoalshedsshinleafsflashgunssplashersflashingssplashiersplashilyslashingschartlessphallismsphallistsgoulashesashplantsshiploadsphallusesscholiastlavisherspushballsshalloonsheadsailsalcahestswashbowlsshealingsshearlegshandlistssquallishselfhealssulphatesshetlandssablefishwaspishlyfishmealsgaslightspashalicsfishtailspashaliksalkahestschalliseschiliasmsasphodelschasubleschiliastssquashilyeyelashesladyshipshalakistsranchlesslangshansschmalzesunleashesshigellasmarshallslithiasisshmaltzesshillalaschlamysesearlshipschloasmasshoaliestwashablessallowishklatschesbasophilsshellacksheathlessplashiesthospitalsslapheadssphacelusoutlashesslapshotsphysaliasslashfestshauchlessnailfishsplatchessmashablehigh-classchainlessscaldfishscaldshipshawlingsshawllesshailshotswashballspharsalusfishballswrathlessshiraleesreachlessshrapnelssinhalesehavenlessbushwalkssandhillsdayshellssaltishlywashlandsphaseolusmailshotsmashlochshaloseresdishableschapelesshartlessetaplashesshedloadsdeishealsschlagersstartlishsealyhamsmasoolahslayshaftsphaselessclanshipsstanchelsrhipsalisthessaliachamisalsteachlessabashlessshoalingsshoalnessshoalwisechrismalsclarsachsplashingsblashiestclashingsshaftlessPhrases (18)
small shipfrans halssilver ashfish scalestar shellshot glassodd hasselbath saltssisal hempslave shiplhasa apsomohs scalesalt marshshop classhand glasssolar dishallis shadshort sale