9-Letter Words Containing: A,C,D,H,Y
(In Any Order)
There are 33 9 letter words,
7 9 letter phrases and
0 9 letter abbr's with
A,C,D,H,Y in.
Best Scoring 9 Letter Words With: A,C,D,H,Y
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| wheyfaced | 9 | 24 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| archduchy | 9 | 23 | nounn | |||||
noun • the domain controlled by an archduke or archduchess | ||||||||
| pachyderm | 9 | 22 | nounn | |||||
noun • any of various nonruminant hoofed mammals having very thick skin: elephant; rhinoceros; hippopotamus | ||||||||
| hackneyed | 9 | 22 | adjectiveadj | |||||
adjective satellite • repeated too often; overfamiliar through overuse | ||||||||
| dichogamy | 9 | 21 | nounn | |||||
noun • The condition in which an organism changes sex during its lifetime. | ||||||||
| headachey | 9 | 21 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| dysphagic | 9 | 21 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| chlamydia | 9 | 20 | nounn | |||||
noun • a sexually transmitted infection caused by bacteria of the genus Chlamydia • coccoid rickettsia infesting birds and mammals; cause infections of eyes and lungs and genitourinary tract | ||||||||
| dysphasic | 9 | 20 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| hyperacid | 9 | 20 | noun, adjectiven, adj | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 9 Letter Words
Words (33)
hydraulicchlamydiacharybdispachydermchandleryhackneyedchrysalidwheyfacedhyracoidsdichogamycaddishlyheadacheyarchduchydysphagicdysphasichyperacidhydracidsdyarchieshydrocastdiachronychlamydesaldehydicschooldaydyschroasdyschroiachairdaysparchedlydyscheziaadhocracyhydrazoicdiachylondiachylumhydnaceaePhrases (7)
ready cashhue and cryspeech dayschool dayhard candyhybrid carday school
