8-Letter Words That Start With: LY
There are 42 8-letter words,
4 8-letter phrases and
0 8-letter abbr's that start with
LY.
Best Scoring
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| lysozyme | 8 | 25 | nounn | |||||
noun • an enzyme found in saliva and sweat and tears that destroys the cell walls of certain bacteria | ||||||||
| lyricize | 8 | 22 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| lymphoma | 8 | 20 | nounn | |||||
noun • a neoplasm of lymph tissue that is usually malignant; one of the four major types of cancer | ||||||||
| lymphoid | 8 | 19 | adjectiveadj | |||||
adjective • resembling lymph or lymphatic tissues | ||||||||
| lynchpin | 8 | 18 | nounn | |||||
noun • a central cohesive source of support and stability • pin inserted through an axletree to hold a wheel on | ||||||||
| lynching | 8 | 17 | noun, adjectiven, adj | |||||
noun • putting a person to death by mob action without due process of law | ||||||||
| lycopods | 8 | 16 | noun, adjectiven, adj | |||||
noun • primitive evergreen moss-like plant with spores in club-shaped strobiles | ||||||||
| lyophile | 8 | 16 | noun, adjectiven, adj | |||||
Valid word for Scrabble US
| ||||||||
| lynchers | 8 | 16 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| lyriform | 8 | 16 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 8 Letter Words
Words (42)
lynchinglymphomalyricistlysanderlychgatelyricismlyonnaislynchpinlysozymelycopodslymphoidlyophilelyriciselyricizelydditeslyncherslyratelylyrebirdlyriconslyriformlysogenylysogenslysosomelycopenelygodiumlykewakelykewalklymiterslymphadslynchetslynxlikelyolyseslynx-eyedlyolysislyophobelysilomalysergiclysipposlysippuslysoformlyallpurlycaenidPhrases (4)
lygus buglynch lawlynch moblynx lynx
