8-Letter Words Containing: PINGS
(In Exact Order)
There are 45 8 letter words,
0 8 letter phrases and
0 8 letter abbr's with
PINGS in.
Best Scoring 8 Letter Words With: PINGS
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| yawpings | 8 | 17 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| hoppings | 8 | 16 | verb, nounv, n | |||||
Valid word for Scrabble US
| ||||||||
| mappings | 8 | 15 | nounn | |||||
noun • (mathematics) a mathematical relation such that each element of a given set (the domain of the function) is associated with an element of another set (the range of the function) • the process of making maps • (genetics) the process of locating genes on a chromosome | ||||||||
| cappings | 8 | 15 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| keepings | 8 | 15 | noun, adjectiven, adj | |||||
noun • conformity or harmony • the responsibility of a guardian or keeper • the act of retaining something | ||||||||
| campings | 8 | 15 | nounn | |||||
noun • the act of encamping and living in tents in a camp | ||||||||
| cuppings | 8 | 15 | nounn | |||||
noun • a treatment in which evacuated cups are applied to the skin to draw blood through the surface | ||||||||
| helpings | 8 | 14 | nounn | |||||
noun • an individual quantity of food or drink taken as part of a meal | ||||||||
| weepings | 8 | 14 | verb, nounv, n | |||||
noun • the process of shedding tears (usually accompanied by sobs or other inarticulate sounds) adjective satellite • showing sorrow • having branches or flower heads that bend downward | ||||||||
| harpings | 8 | 14 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 8 Letter Words With PINGS In Order
Words (45)
raspingshelpingsmappingstappingscappingsweepingscarpingsharpingstoppingsyawpingskeepingscampingscuppingsdumpingslippingsdampingshoppingsloopingsrappingsshapingsdippingsstopingsjumpingslappingsloppingsbumpingscompingssnipingsdoppingstampingsvampingsyelpingslimpingsreppingssoopingshippingswarpingskempingsrampingsrispingssoppingsgaspingstippingslampingslispings
