8-Letter Words Containing: I,N,C,E,Y
(In Any Order)
There are 78 8 letter words,
3 8 letter phrases and
0 8 letter abbr's with
I,N,C,E,Y in.
Best Scoring 8 Letter Words With: I,N,C,E,Y
Expand? | Word | Save? | Length | Usage | Points | Type | ||
---|---|---|---|---|---|---|---|---|
benzylic | 8 | 24 | adjectiveadj | |||||
adjective • relating to benzyl | ||||||||
exigency | 8 | 21 | nounn | |||||
noun • a pressing or urgent situation • a sudden unforeseen crisis (usually involving danger) that requires immediate action • that which is required in a particular situation —usually used in plural. | ||||||||
oxygenic | 8 | 21 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
hyphenic | 8 | 21 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
chevying | 8 | 20 | verbv | |||||
verb • annoy continually or chronically | ||||||||
feminacy | 8 | 18 | nounn | |||||
Valid word for Scrabble US
| ||||||||
chimneys | 8 | 18 | nounn | |||||
noun • a vertical flue that provides a path through which smoke from a fire is carried away through the wall or roof of a building • a glass flue surrounding the wick of an oil lamp | ||||||||
phenylic | 8 | 18 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
hygienic | 8 | 17 | adjectiveadj | |||||
adjective satellite • tending to promote or preserve health | ||||||||
cytokine | 8 | 17 | nounn | |||||
noun • any of various protein molecules secreted by cells of the immune system that serve to regulate the immune system | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
All 8 Letter Words
Words (78)
cylinderhygienicmckinleyleniencytenacityunicycleprincelypicayuneglycerincinerarycytokinecytosineeminencyexigencyneomycinhyoscinesaliencycytidinedecoyingoxygeniccyanidessynecticdecryingdecayingbenzylicsyndeticsyeniticcysteinepyogenicchevyingfeminacychimneyssynclineensigncyencycliccooeyinggynaeciacalycinecyanidedsapiencyphenylicgyneciumcyaninesgynecoidcyanitessynergicgynoeciamyceliandysgenicsycaminesyngenicpolyenicsnickeryglycinesmyelinicdeviancydyspneiccysteinscystineshyphenicvicenarymyogeniceponymicadenyliconychitehyacinescyanisedcyanisescyanizedcyanizesreccyingencycliasynechiaconceitysyntenicpycnitescytisinelycaenidPhrases (3)
by inchestonic keycity line