Dictionary Only:
Profanity Off:

8-Letter Words Containing: H,A,E,N

 (In Any Order)
There are 692 8 letter words, 66 8 letter phrases and 0 8 letter abbr's with H,A,E,N in.

Best Scoring 8 Letter Words With: H,A,E,N

Expand?WordSave?LengthUsagePointsType
chazzens8
31 verbv
Valid word for Scrabble US
khazenim8
26
Valid word for Scrabble US
hazelhen8
23 nounn
Valid word for Scrabble US
humanize8
22 verbv
verb

• make more humane

phenazin8
22 nounn
Valid word for Scrabble US
exchange8
21 verb, nounv, n
noun

• chemical process in which one atom or ion or group changes places with another

• a mutual expression of views (especially an unpleasant one)

• the act of changing one thing for another thing

• the act of giving something in return for something received

• a workplace that serves as a telecommunications facility where lines from telephones can be connected together to permit communication

• a workplace for buying and selling; open only to members

• (sports) an unbroken sequence of several successive strokes

• reciprocal transfer of equivalent sums of money (especially the currencies of different countries)

• the act of putting one thing or person in the place of another:

• (chess) gaining (or losing) a rook in return for a knight or bishop

• (chess) the capture by both players (usually on consecutive moves) of pieces of equal value

verb

• give to, and receive from, one another

• exchange or replace with another, usually of the same kind or category

• change over, change around, as to a new order or sequence

• hand over one and receive another, approximately equivalent

• put in the place of another; switch seemingly equivalent items

• exchange a penalty for a less severe one

newshawk8
21 nounn
noun

• A keen investigative reporter.

hazelnut8
20 nounn
noun

• any of several shrubs or small trees of the genus Corylus bearing edible nuts enclosed in a leafy husk

• nut of any of several trees of the genus Corylus

exanthem8
20 nounn
noun

• eruption on the skin occurring as a symptom of a disease

haziness8
20 nounn
noun

• vagueness attributable to being not clearly defined

• cloudiness resulting from haze or mist or vapor

or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 8 Letter Words

Words (692)
anywherehandsomeexchangeteachingcheatingelephantvanishedthreatenreachinghomelandmechanicheavenlychannelsmerchantfreshmanhangoverheadlinejohanneschandlernazarethhorsemanenhancedbohemianlauncherskinheadunharmedhardenedshrapnelepiphanychechnyaorphanedboneheadsheridanephesianhandoverheadbandhaciendahesitanthandmadeearthmanhenchmanexhalinginhumaneeichmannhairlinelutheranabsinthesheratonpheasantcomanchesunbathepathogensnatcherpantheonheadsmanunwashedpenchanthousemanhardnesshazelnuthumanelyherdsmanchaperonhandheldthespianshearingunshavenszechwanshenyangheadlongforehandathenianearphoneencroachrelaunchshetlandhelmsmanstendhaldauphinesherwanioverhangbranchedanathemaverandahhumanizeoverhandthiamineheadwinddeckhandmethanolstephaneadheringenthrallunshavedtashkentlunkheadplanchetphalangehardlineenhancerwheelmansydenhamhabanerocenotaphhandiestuncashednailheadschnabelhandlesswelshmanshamisenadhesionchanceryrashnesshegelianstanhopeunhealedanaphaseanechoicszechuanmachinedurethanehannoveradherentanhedralchaldeanunhailedhawknosehogmenayunthawedhumaniseblancherunshakenatherinesenhorasunbathedhalftoneheadhuntleachingmannheiminchoateheadlandfreehandantiherounheatedethnicalvacherinnehemiahhabanerablanchedbankheadunchasterancheroheartingchessmanharangueunsharedatheneumasthenichandsewnhotelmanmenhadenhibernalexanthemnarghilenargilehsunshadehalenessbechanceunshapedarchaeananthesishazinessinsheathchancersechidnasearthmenhandaxesechinateheadingschancressnatchedheparinssnatcheshappenedreshavenphonatedhardenercheapensheadnoterehardenswanherdchangeuphaunchesencashedbarehandbethanksinswathekhanateswhalemanyachtmenwhalemenheadsmenchantagemachineshyalinesenswathevanishesleashinghandlerschoremanmenarchehalogensenchainsunswatheingatherenchantshyoideanharshensleathernhaematinmenorahshypogeanhandselsplancheshandsetswhatnessenravishenhaloedunhairedzenithalenhaloesenhancesfellahincoachmenchastensunearthsunhangedhandymenbranchesstanchedheartenshangaredshanteysshantiesstancheshangfirerebranchranchmentrancheshessiansunhattedanchoredanchorethastenedhastenerunlethalhankeredunthreadbehavingenthralswatchmennathlesscatechinnanotechharkenedheptagonanthemiceulachongnathiteathelingensheathethnarchchaunterachinesspanacheshennainghandbellsharpenshymenealaphaniteaphelionganachessheepmanharmineswaterhenhanaperspentarchchancelschicanedchicanerdakerhenachenialshagreenbrechansechidnaechicaneslongheadastheniachancierdeashingelaphinehornbeamadherendashinesshermaeanchazzenshexosansphonatesrehandlehapteneshaptenicrehangednaethingchangersacanthaehaunchedhypopneachainmenxantheinheadpinsxanthenehauntersencashesnautchesweighmanrevanchexanthateperianthendarchyredshankxanthinemanholesarchnesshackneyssaphenaeendashessaphenasearthingcharnelsdiaphoneherniatekhamseenbanishedbanishercranchedearthnutkephalincranchesbanishesxanthonehymenialchairmenabhenryssheafingpeachingseraphinenthalpyinchmealshealinginearthschantersanetholeetchantschanteyspanthershaveningchantieshandlikekhazenimwhangeeshyalogenhaveringphytanesheptaneswreathencanephortheriansenchasedenchaserenchasessheavingthebaineshebangshairnetsshebeansunchargedasheenssandshoeanetholsjacinthearchaeonunhairerethanolsinarchedinarchesunarchedhearingsstengahsunhalvedunhandedhogmaneshearkensbansheesbeachingbanshiesnewshawkurethanspaunchedshandiespauncheswheatenshearsingunlashedunlashesraunchescampheneankushescamphinechaloneshardnoseneatherdrechangemanchetshyponeasshannieshangablehuntablestanchericekhanaranchersthenagesdeanshiphambonedtrashmenhamboneshangnestnympheanhumanesthalazonethionatehankererblanchescrenshawmethadonhenbanesstheniasatechnicunshadedaphelianhexagonsnarwhalepheloniahazelhenpinheadsunshapenexhalantcephalinexhalentunshamedthanagesshinleafarchineshanseledethicianvanisherantheliahalfnessanthelixsheitanspainchesphenatesharkenerphenazinanthemeddanisheseulachangahnitesanthemialaunchedlaunchesthiazinehoarsensinhalersantheridchauntedheathensantheralphaetonschaconnehexamineinhauleranthesesthankersheadendshemateinpanochesprehumanhematinerhamnosemethaneshematinsparishenwanhopesdelphianenwreathenanthemphenogamcheloniaantithetheavingspancheonbarchanebenghaziarsheensbeathingarshineshebetantthatnessobeahingpayphoneunpreachhandlinepenthiasunsashedinhumatehapteronchainletconchatephonecamcheapinghornbeakhandrestundashedhaurienthandfeedhaquetonsneakisheuphoniaheadringcharneconenupharsherangschannershandwearhymeneanswamphenhainchedhainchessheadinginchasedinchaseshernshawhyacinesanesthylgaunchedgaunchesshiremanchalanedenchafedenchafespantherashearmanshearmenphocoenasandheapquechuanhanger-onsneeshanemmantheskeechanenchargepay-phonehauncherwharenuihealdingesthoniaencharmsleft-handgenizahshealingsgoetheanunpathedgoethiannaythlestarwhinenetheadsseahoundhindheadhartenedplanchedcynanchenymphaeahernariaethanalsunhackedhiberniaspanghewberghaanethanoicxenophyaianthinethrangedethanoylshoremanhaminoeaunhalsedenhearsehielamanpheniciafernshaweranthisraunchedcamphanesynechiauneathesbrancherthreadenmarchmencalanthehanepootdushanbestanchelchatlinebechuanaalebenchpathnameamaethonsynapheaunhaspedoenanthetranchetflanchedflancheshuxleianhuxleyanbahreiniunhealthdanelaghhertzianbenthoalbehappenthallineunhearsemethanalmorpheanunshakedachaeniaunheartsunshaledhaemitinunshalessharemansharementanekahaunwashenunshapesgnashershand-heldunheadedacheniumchauncedchaunceshand-hewnanthemisrondacheeschatonphaethonchaungedchaungesabthanesheadbangaphoniesthanedomhard-linehaterentchinamenchange-uphoastmensharniermanicheehexanoicinhearseheatingsschansesschantzehymenaeasechuanaenarchedschanzesenarcheshaemulon
Phrases (66)
white antsea nymphmash beanwen ch'angwhite manax handlehave downmarsh henmore thanin the rawin the waycape hornr. h. tawneywater henjohn cageat lengthcatch penhalf noteben hoganhand overhand visewear thinby chancefree handheat sinkheat unithead lineheath henhead tonebone charred chinatien shanfin whalehome loanlone handhen partybent hangjunk heapmoth beannew havenon the waysash linehired mandead handgather ingreen ashlab benchin the airhammer intax havented shawnhawk nosemaori henchance onhand fernhyena doghand linenail holeben shahnbush beanhand wearnaja hajeacre inchnorth seahard fernhard news
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen