8-Letter Words Containing: E,I,M,Y
(In Any Order)
There are 156 8 letter words,
12 8 letter phrases and
0 8 letter abbr's with
E,I,M,Y in.
Best Scoring 8 Letter Words With: E,I,M,Y
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| ribozyme | 8 | 24 | nounn | |||||
noun • A fragment of RNA that can act as an enzyme. | ||||||||
| jemmying | 8 | 23 | verb, nounv, n | |||||
verb • To shoehorn, to cram. • To pry (something, especially a lock) open with or as if with a crowbar. | ||||||||
| mystique | 8 | 22 | nounn | |||||
noun • an aura of heightened value or interest or meaning surrounding a person or thing | ||||||||
| isozymes | 8 | 22 | nounn | |||||
noun • An isoenzyme | ||||||||
| hyphemia | 8 | 21 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| oximetry | 8 | 20 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| hymnlike | 8 | 20 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| chimbley | 8 | 20 | nounn | |||||
noun • A vertical tube or hollow column used to emit environmentally polluting gaseous and solid matter (including but not limited to by-products of burning carbon or hydrocarbon based fuels); a flue. • The glass flue surrounding the flame of an oil lamp. • The smokestack of a steam locomotive. • A narrow cleft in a rock face; a narrow vertical cave passage. | ||||||||
| empyemic | 8 | 19 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| whimseys | 8 | 19 | nounn | |||||
noun • an odd or fanciful or capricious idea • the trait of acting unpredictably and more from whim or caprice than from reason or judgment | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 8 Letter Words
Words (156)
dynamiteseminaryplaytimeemissaryemptyingmckinleymystiqueuntimelysystemicdimethylenormitydismayedmediallytemeritydreamilyemulsifyminutelyyosemitefeminitymoseyingoximetrymyelitisglimmerymaidenlyshimmeryeminencyneomycinhermitryyummiesthymnlikeremodifymyceliummyceloidepimysiaribozymelimberlysmitheryisozymesmayfliesfeminacychimneysjemmyingdairymenhymeniumsymbiotemistypedmistypesthymiestthyminesbimethylcreamilyremisslyimpurelymisyokedmisyokeshymenialmethylicbigeminygyneciumsteamilymidyearstyramineempyemiccomelilydaytimesyohimbesmegacitymycelialmycelianmeniallymisentrysycaminemisstylelechayimmyeliniclehayimsmythiestmislayerfogeyismwhimseysisometryembayingembryoidmyelineschimbleytaleysimmedianlypyaemiasmylonitechimleyshyphemiarimoselybiometrymesiallymyogeniceponymiceuonyminorumiyehemictorymickeyeddemyshipmebibytemysolinehydremiasymitaregempyliddysmeliadysmelicyealmingready-mixlymiterssmearilymoyitiesdemisslymytilenemethysismaitreyamyacidaesymphilemyrrhineemptysisnyamwezidynamisegeomyoiddynamizeempyesisglycemiaisocrymeglycemicmycteriamiskeyedentryismeryngiumerysimumsmytriesmythisedmythisesmythizedmythizeslaytimeshomelilymulteityimmanelymerycismpeyotismazymitesgymnelisfemalityeuthymiabogeyismemydidaeshimmeysemeryingmeiocytemyrmeciapuseyismPhrases (12)
minor keybig moneymilk wheypin moneymagic eyesi systemmind's eyeptolemy imerit paytim learywhite yamsilky elm
