8-Letter Words Containing: E,D,I,S,H
(In Any Order)
There are 211 8 letter words,
5 8 letter phrases and
0 8 letter abbr's with
E,D,I,S,H in.
Best Scoring 8 Letter Words With: E,D,I,S,H
Expand? | Word | Save? | Length | Usage | Points | Type | ||
---|---|---|---|---|---|---|---|---|
squished | 8 | 21 | verb, adjectivev, adj | |||||
noun • the noise of soft mud being walked on verb • walk through mud or mire • put (a liquid) into a container or another place by means of a squirting action | ||||||||
khedives | 8 | 19 | nounn | |||||
noun • one of the Turkish viceroys who ruled Egypt between 1867 and 1914 | ||||||||
sheikdom | 8 | 18 | nounn | |||||
noun • the domain ruled by a sheik | ||||||||
whishted | 8 | 18 | ||||||
Valid word for Scrabble US
| ||||||||
headfish | 8 | 18 | nounn | |||||
noun • among the largest bony fish; pelagic fish having an oval compressed body with high dorsal and anal fins and caudal fin reduced to a rudder-like lobe; worldwide in warm waters | ||||||||
kiboshed | 8 | 18 | verbv | |||||
verb • stop from happening or developing | ||||||||
milkshed | 8 | 18 | nounn | |||||
Valid word for Scrabble US
| ||||||||
famished | 8 | 17 | adjectiveadj | |||||
adjective satellite • extremely hungry | ||||||||
cowhides | 8 | 17 | nounn | |||||
noun • leather made from the hide of a cow • the hide of a cow • a heavy flexible whip braided from leather made from the hide of a cow verb • flog with a cowhide | ||||||||
headship | 8 | 17 | noun, adjectiven, adj | |||||
noun • the position of headmaster or headmistress • the position of head | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
All 8 Letter Words
Words (211)
finishedpunishedvanishedpolisheddemolishstitchedskinheadperishedfamishedsheddingsheridanhillsidedevilishshieldedadhesivesideshowfiendishsondheimsphenoidhedonismmisheardchiseledrhodesiashimmiedsulphideshriekedhandiestadhesionhedonistsheikdomunwishedheadsaildishwarehardiestshielderslightedechidnasdehiscedheadingssiphoneddelightsbedightslavishedcowhidesmonishedunfishedheadshipsquishedhedonicshideoutsdhurriesshrilleddisheritminishedshiveredsmircheddishiestinmeshedswitchedethmoidsrawhidesrachidesthirstedsidehillshoddiershoddiesdepolishrelishedradishesshipsidehordeinshirseleddehiscesheadiestdeashingshinnieddinghiesdreggishairheadsreshinedhagridessemihardwhishteddiehardsheadpinsshendingditchersredshiftstithiedditheismheadfishditheistbanishedwhistledspheroidraphidesairshedsbishopeddiethershoodiestbigheadskhedivesshrewdiedogeshipchediteshelipadsdhooliespitheadshedgiestshammiedhidelessdhootiesceilidhsdashiestshrievedshedlikehidrosesdishelmsshandiesshrimpeddweebishdealfishdishlikewhimsieddeanshipkibosheddishevelhayrideshydridessleighedpinheadsravishedshadiestheirdomsdanishesmilkshedcheloidsredshirtsnitchedcepheidsshindiesimmeshedshingledthristedsidepathdisfleshscaithedhumidesteddishesshintieddemyshipsphecoidskaithedechoisedwhaisledbesighedshoogiedschiedamheadrigsendshipssheadinginchasedwhidderssephardihemipodsheroisedkhedivasshreikeddiethylsdishabledisthenehindlegsshoebirddashekishairstedhedgingshebridespheidiasdeishealdrisheenshidderslinishedmythisedeadishesskitcheddisbenchdespightdishomeddishomeshoicksedhesperidtedeschidishorsedukeshipdishousepseudishjehadismsmithiedjehadistdiphonesshe-devilspightedsiwashedatheisedsylphidegarishedchuddiesredshirephysidaechiausedenshieldPhrases (5)
hand visered shiftside dishside withsheep dip