8-Letter Words Containing: D,E,H,M
(In Any Order)
There are 151 8 letter words,
8 8 letter phrases and
0 8 letter abbr's with
D,E,H,M in.
Best Scoring
Expand? | Word | Save? | Length | Usage | Points | Type | ||
---|---|---|---|---|---|---|---|---|
shmoozed | 8 | 23 | verbv | |||||
verb • To talk casually, especially in order to gain an advantage or make a social connection. | ||||||||
demijohn | 8 | 21 | nounn | |||||
noun • large bottle with a short narrow neck; often has small handles at neck and is enclosed in wickerwork | ||||||||
homebody | 8 | 19 | nounn | |||||
noun • a person who seldom goes anywhere; one not given to wandering or travel | ||||||||
chiefdom | 8 | 19 | nounn | |||||
noun • An area or region governed by a chief. • A society larger than a tribe but smaller or simpler than a state. | ||||||||
hypoderm | 8 | 19 | ||||||
Valid word for Scrabble US
| ||||||||
berhymed | 8 | 19 | verbv | |||||
Valid word for Scrabble US
| ||||||||
hempweed | 8 | 19 | ||||||
Valid word for Scrabble US
| ||||||||
chefdoms | 8 | 19 | nounn | |||||
Valid word for Scrabble US
| ||||||||
sheikdom | 8 | 18 | nounn | |||||
noun • the domain ruled by a sheik | ||||||||
chammied | 8 | 18 | ||||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
All 8 Letter Words
Words (151)
handsomehomicidehomelandmohammedhomemademeredithdemolishhammeredmadhouseunharmedfamishedhandmadeheadsmanmeatheaddimethylsondheimherdsmansmoothedhedonismmisheardhomewarddumbheadheadroomshimmiedsydenhammastheadwhoredommachinedenmeshedsheikdomhelmetedhomebodyhomebredhempseeddrumheadmenhadensmoochedmethodicbeshamedheadmosthoteldomdemarchechiefdomrehemmedmonishedheadsmenhumoureddemijohndutchmenthrummedhydromelminishedfathomedsmirchedhandymenambushedinmeshedemdashesherdsmengumshoedshmoozedethmoidshamperedhematoidsmooshedrhumbaedsemihardchromideditheismheadlampunrhymedshambledhypodermhebdomadsmutchedshammiedoompahedunmeshedshamoyedberhymeddishelmsshrimpedwhimsiedchamadeshambonedmotheredhempweedshlumpedmethadonchefdomsdrachmaehumifiedunshamedchammiedunhelmedheirdomsanthemedmilkshedrhabdomehalidomemudholesimmeshedmudiriehmerchildhumidestheadmarkdemyshiphydremiawhummledhomodynesmatchedgrumphedmopheadsimbathedschiedamemmeshedsmouchedrhythmedmitheredsmeechedstemheadhadromeshemipodsthimbledweldmeshhardbeamholydamewaldheimmythiseddurkheimembathedmythizedwhimpleddishomedmerodachdishomesram's-headshroomedjehadismsmithiedleechdomchimeridshmoosedwhombledheimdallwhommledthanedomwhemmledhumectedhemipodehumefiedPhrases (8)
hard timehead gamehead homehead smuthemp seedhired manhad crimedutch elm