7-Letter Words Containing: P,A,Y,E
(In Any Order)
There are 110 7 letter words,
7 7 letter phrases and
0 7 letter abbr's with
P,A,Y,E in.
Best Scoring 7 Letter Words With: P,A,Y,E
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| jaspery | 7 | 19 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| pyrexia | 7 | 19 | nounn | |||||
noun • a rise in the temperature of the body; frequently a symptom of infection | ||||||||
| epitaxy | 7 | 19 | nounn | |||||
noun • growing a crystal layer of one mineral on the crystal base of another mineral in such a manner that its crystalline orientation is the same as that of the substrate | ||||||||
| apteryx | 7 | 19 | nounn | |||||
noun • nocturnal flightless bird of New Zealand having a long neck and stout legs; only surviving representative of the order Apterygiformes | ||||||||
| empathy | 7 | 17 | nounn | |||||
noun • understanding and entering into another's feelings | ||||||||
| cheaply | 7 | 17 | adverbadv | |||||
adverb • in a stingy manner • in a cheap manner • with little expenditure of money | ||||||||
| preachy | 7 | 17 | adjectiveadj | |||||
adjective satellite • inclined to or marked by tedious moralization | ||||||||
| eparchy | 7 | 17 | nounn | |||||
noun • a province in ancient Greece • a diocese of the Eastern Orthodox Church | ||||||||
| nymphae | 7 | 17 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| keypads | 7 | 17 | nounn | |||||
noun • a keyboard that is a data input device for computers; arrangement of keys is modelled after the typewriter keyboard | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 7 Letter Words
Words (110)
therapypaymentpenaltyempathyparsleypeabodycheaplysynapsepayableshapelypreachypaisleyplaypenpageboyreapplyaplentypeccarymaypoleplayletdyspneapasskeyplenaryspywarelampreyhyphemasprayerdraperyoverpayplagueyrespraypalfreypenallypatencyeparchyyapperssprayedsplayedsparelyprayerspedlaryparleysnymphaekeypadshypogeaendplayectypalcypselaadeptlyyawpersyauperstypebartypableteapoysreplayspygmeanpyemiaspterylaprepaysplayersphytanepeytralpeaveyspeartlypartyerkeypalsjasperyhyponeagraperyclypealapyraseapetalyropewaypyrexiapyaemicpyaemiaprelacypessaryepitaxyempyemaapteryxyapsteryappiesyappieryampiessynaptesprayeypyebaldprelatypetrarypeaterypeatarypaysagepayfonepaneitypacewaymapperyhypatesepylliaepularyempayrecacoepybyplaceappuyedy-shapedspyeriashapleyplasseyha'pennydynapencypraeaPhrases (7)
pay rateper yearpeg awaypay heedleap daykey palmcape may
