7-Letter Words Containing: A,I,P,Y
(In Any Order)
There are 86 7 letter words,
4 7 letter phrases and
0 7 letter abbr's with
A,I,P,Y in.
Best Scoring
Expand? | Word | Save? | Length | Usage | Points | Type | ||
---|---|---|---|---|---|---|---|---|
pizazzy | 7 | 39 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
hypoxia | 7 | 22 | nounn | |||||
noun • oxygen deficiency causing a very strong drive to correct the deficiency | ||||||||
pyxidia | 7 | 20 | nounn | |||||
noun • A seed capsule in the form of a box, the seeds being released when the top splits off. | ||||||||
kopiyka | 7 | 20 | nounn | |||||
noun • 100 kopiykas equal 1 hryvnia in Ukraine | ||||||||
pawkily | 7 | 19 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
pyrexia | 7 | 19 | nounn | |||||
noun • a rise in the temperature of the body; frequently a symptom of infection | ||||||||
epitaxy | 7 | 19 | nounn | |||||
noun • growing a crystal layer of one mineral on the crystal base of another mineral in such a manner that its crystalline orientation is the same as that of the substrate | ||||||||
panicky | 7 | 18 | adjectiveadj | |||||
adjective satellite • thrown into a state of intense fear or desperation | ||||||||
shipway | 7 | 18 | nounn | |||||
noun • structure consisting of a sloping way down to the water from the place where ships are built or repaired • a canal large enough for seagoing vessels | ||||||||
whipray | 7 | 18 | ||||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
All 7 Letter Words
Words (86)
playingtypicalhappilyprivacyprimarydisplaypyramidrapidlyyappingplainlyolympiapanickypaisleyamplifytopiarycyprianairplaypaucityhypoxiaslipwaypythiasphrygiaspayingprimacypicardyshipwaypayslipopacityhypatiatympanipyralidpliancypiscarymisplayprayingpliablyplatypipizazzypaynimsmyopiasinaptlyyawpingyaupingwhipraywaspilysoapilysappilypyxidiapyuriaspygidiapyemiaspitayaspirayaspawkilygiddyapdiptycacampilybipartyapishlyvapidlypyrexiapyaemicpyaemiaptyalinopacifykopiykaepitaxyyappiesyappieryampiespyramispravitypolyniapayingspastilypaneityjipyapaepylliacaprifyapayingyavapaixylopiaspyeriapyralisoxyopiaaplysiaPhrases (4)
pay dirtsick paylily padinky cap