6-Letter Words Containing: Y,N,E
(In Any Order)
There are 311 6 letter words,
5 6 letter phrases and
0 6 letter abbr's with
Y,N,E in.
Best Scoring 6 Letter Words With: Y,N,E
Expand? | Word | Save? | Length | Usage | Points | Type | ||
---|---|---|---|---|---|---|---|---|
frenzy | 6 | 21 | nounn | |||||
noun • state of violent mental agitation | ||||||||
enzyme | 6 | 20 | nounn | |||||
noun • any of several complex proteins that are produced by cells and act as catalysts in specific biochemical reactions | ||||||||
enzyms | 6 | 20 | nounn | |||||
Valid word for Scrabble US
| ||||||||
benzyl | 6 | 20 | noun, adjectiven, adj | |||||
noun • the univalent radical derived from toluene | ||||||||
sneezy | 6 | 18 | adjectiveadj | |||||
adjective satellite • inclined to sneeze | ||||||||
exonym | 6 | 18 | nounn | |||||
Valid word for Scrabble US
| ||||||||
oxygen | 6 | 17 | nounn | |||||
noun • a nonmetallic bivalent element that is normally a colorless odorless tasteless nonflammable diatomic gas; constitutes 21 percent of the atmosphere by volume; the most abundant element in the earth's crust | ||||||||
hyphen | 6 | 17 | nounn | |||||
noun • a punctuation mark (-) used between parts of a compound word or between the syllables of a word when the word is divided at the end of a line of text verb • divide or connect with a hyphen | ||||||||
jitney | 6 | 16 | verb, nounv, n | |||||
noun • a vehicle carrying many passengers; used for public transport | ||||||||
unsexy | 6 | 16 | adjectiveadj | |||||
adjective • not sexually aroused or arousing | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
All 6 Letter Words
Words (311)
anyoneenergytwentybeyondplentylonelynearlymonkeyagencynearbyoxygennicelydonkeygentlysydneykidneyninetydisneybarneysidneyyankeeopenlysneakyuneasyfelonyconveyentityyondertrendynamelyfrenzyneatlyphoneyevenlygurneyenmitykeynesenzymekinseyhoneysfinelyeyeingsentryteensyhenleymyelintunneycarneygentrymoneysorneryjitneystoneykeenlyweensybygonedyeingboleynwineryyeomanhyphenfinerycagneysweenydrydenlysinedinkeysheenyceylongyrenepenurybylineunsexykenyankeyingyemenitweenywyvernnicetygeryonphenylsneezysinewywhineymeanlylemonylinneydoyensyawnertawneysanelyhoydengreenytetanyleydengooneyhorneyundyedresinylenityhyaenaetymonethynedenaryalkyneyonkeryentasyennedyearnsyeanedyawnedyankedsyncedspendysneeryniteryleanlylaymenhymnedenvoysencystconeysbetonyunyokecygnetyeomenyentesyeelinyarneryarnedyamenswitneyvenerysyrenssyndetsnakeyskymensenryusenarysawneyredenypyronepoleynpinkeypinerypentyloogenyonyxesnudelynoyadenettlynebulylynxeslinseylinenylanelyhymenshyenichyenashunkeyhenrysflymenexonymenzymsennuyeenjoysdynodedynelsdyneindingeybendysbaymenadenylxylenewinceyvineryselsynpyrenepunkeynaperymangeygroyneeryngoeponymcymenebyrniebynameblennybenzylbendayanergyyunxesyshentyshendyrnehsyonnieyittenyexingyevingyedingybrentyblentyankiewinseyveneysunredyungyveuneyedtyeingtraynetoymentinseythyineteentysyndedsyeingstaynesnideysnellyseyensscrynesarneyroynesroynedrhynesrenvoyreneysrenaysraynesqueynsqueenypyonerpyeingproyneprewynpowneyponeysponceypioneyoneyreoneyernyasesnoseysnextlyneedlymyogenmyelonmenyiemeineylynagelunyielenvoylarneykyogenkyndeskyndedjynxeshyndeshyeinghydyneheyinghauynegynneygyniesgynaesgyldengemonygeminyganseyfoynesfoynedfeyingfaynesfaynedesnecyegencydesynedernlydenaysdawneydanceycurneycovynecentrybylanebungeybenchyanerlyyes-manyersinyankerwynneasynsetseyhanpayenapaeonyone-waynybbleniameyneomysnentsynasebymyxinemayenglenifykonoyehankeye-mycinczernyby-linebonneyPhrases (5)
henry irely ono. henrynut keyhenry v