6-Letter Words Containing: Y,E,E
(In Any Order)
There are 200 6 letter words,
4 6 letter phrases and
0 6 letter abbr's with
Y,E,E in.
Best Scoring 6 Letter Words With: Y,E,E
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| exequy | 6 | 25 | nounn | |||||
noun • (now only in plural) Funeral rites. | ||||||||
| wheezy | 6 | 24 | adjectiveadj | |||||
adjective satellite • having a tone of a reed instrument • relating to breathing with a whistling sound | ||||||||
| enzyme | 6 | 20 | nounn | |||||
noun • any of several complex proteins that are produced by cells and act as catalysts in specific biochemical reactions | ||||||||
| breezy | 6 | 20 | adjectiveadj | |||||
adjective satellite • fresh and animated • abounding in or exposed to the wind or breezes | ||||||||
| veejay | 6 | 19 | verb, nounv, n | |||||
noun • Someone who presents a television programme of videos; a video jockey. • Vagina, vulva. verb • To work as a video jockey; to present videos. | ||||||||
| jayvee | 6 | 19 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| cheeky | 6 | 18 | adjectiveadj | |||||
adjective satellite • offensively bold | ||||||||
| sneezy | 6 | 18 | adjectiveadj | |||||
adjective satellite • inclined to sneeze | ||||||||
| wheyey | 6 | 18 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| oyezes | 6 | 18 | ||||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 6 Letter Words
Words (200)
energydeeplyjerseycreepymerelysleepygreedyfreelyherebyyelledwesleyyankeecheekyweeklyremedykerseycheesyspeedyyippeeevenlykeynesenzymeheresyeyeingceleryteensyhenleyeyelidcheerybreezyeaterydeejaygeyserleewaymedleytweedykeenlyweensysteelyeyefulleakeysweenysheenyeerilyyesteryellerlycheeredeyegyrenemeeklyfeeblyyemeniseemlytweenysneezywheezysleekyemperyretypegreenypeaveyleydengreyedfleecyeyeletcybelesleetyethyneyessesyessedyerkedyennedyelperyelpedyeanedtuyeresneerypreyedpayeesobeyermycelemeetlygreyereyriesexequyectypeechoeydweebycrepeyyogeesyeukedyeomenyentesyeelinwheyeyveneryveejaytepefysyceessweepyrekeysreechyredyesredyedredenyredefypreyeroyezesoxeyesobeyedlyceeskeysetjayveejaygeeheydeygleyedgleetyfleyedfeyesteyebareyasesennuyeemydesdebyescyesesbugeyebeechyxylenereverypyreneeyecupcymenebigeyeyettieyeskedyerdedyemmeryelmedwheelywaxeyeverreyveneysuneyedtwyeretweelyteentysweyedsweetysteyersteerysteepysteedysleezyskeeryskeelysheetysheepyseyensseveryreneysreestyqueenypeysespeysedpeeoysoyesesoneyreoneyerneedlymudeyemenyiemeineykeksyeheryesheryedgeyestfreetyeyaletesnecyeggeryegencyebayerdesynecreekybreyedberleybedyesbedyedbedydealeyesaleyedyerkestie-dyered-eyeox-eyedhevesyeyeishcerylebye-byeaye-ayePhrases (4)
hex keyeye cupe layerbee fly
