15-Letter Words Containing: P,Y,R,A,N,S
(In Any Order)
There are 81 15 letter words,
75 15 letter phrases and
0 15 letter abbr's with
P,Y,R,A,N,S in.
Best Scoring 15 Letter Words With: P,Y,R,A,N,S
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| sulfinpyrazones | 15 | 32 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| polymerizations | 15 | 31 | nounn | |||||
noun • a chemical process that combines several monomers to form a polymer or polymeric compound | ||||||||
| psychometrician | 15 | 29 | nounn | |||||
noun • A person who administers psychometric tests. | ||||||||
| proselytization | 15 | 29 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| hypervigilances | 15 | 29 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| phosphorylating | 15 | 29 | verbv | |||||
verb • To cause phosphorylation • To undergo phosphorylation adjective • That phosphorylates. | ||||||||
| lymphangiograms | 15 | 29 | nounn | |||||
noun • an angiogram of the lymph nodes and lymph vessels made after the injection of a radiopaque substance | ||||||||
| interparoxysmal | 15 | 29 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| hypochondriases | 15 | 29 | noun, adjectiven, adj | |||||
noun • chronic and abnormal anxiety about imaginary symptoms and ailments | ||||||||
| hypochondriasis | 15 | 29 | nounn | |||||
noun • chronic and abnormal anxiety about imaginary symptoms and ailments | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 15 Letter Words
Words (81)
polyunsaturatedinspirationallyneuropsychiatryultrasonographytrypanosomiasissuperabundantlypsychometricianpsychohistorianproselytizationpolymerisationshypervigilanceshypersalivationcyproheptadinespolycrystallinetrypanosomiasessulfinpyrazonessemipornographypseudopregnancypresynapticallyprayerfulnessespolymerizationsphosphorylationphosphorylatingphenylthioureasnonpsychiatristlymphangiogramsionosphericallyinterpersonallyinterparoxysmalhypochondriaseshypnotherapistshyperventilateshypersalinitieshyperinflationscryoprotectantsprepositionallyhypochondriasiscrossopterygiananisotropicallytriphenylaminestranscriptivelysupranationallysupplementarilysupernationallysulphinpyrazoneslumpflationaryseptentrionallypyrotechnicianspsychoanalyzerspsychoanalysersprosenchymatousproselytisationpropylitisationpropositionallyprogressionallyprocrastinatorypresbyterianizepresbyterianisepharyngoscopiespharyngologistslaryngoscopistshypomenorrhoeashypocrystallinehypochondriastshypochondriasmshyperpolarisinghypernatraemiashalfpennyworthsempyreumatisingbrachypinakoidsanthropopsychicandrogynophoresaerohydroplanestransposabilityself-explanatorypresbyterianismpanhysterectomyhyperadrenalismgymnosporangiumcryptacanthodescampylorhynchusPhrases (75)
styrax japonicumstonecrop familyspiny-headed wormslender lady palmshorthand typistscholarly personphyseter catodonpersonality testoperating systemmask of pregnancymagnetic pyritesinsurance policygenus hyalophoragenus dasyproctabrittany spanielbirthday presentalimentary pastewomen's army corpstransfer paymenttaymyr peninsulataimyr peninsulasyrian bean capersynapsid reptilesynagrops bellusstringybark pinespinal accessoryscrew-pine familypulmonary plexisprunus dasycarpaprunus amygdaluspresident taylorprecentral gyruspond bald cypressplayground slidepeter stuyvesantpenstemon parryipasserina cyaneaparry's penstemonparis universityoral personalitynews photographymost importantlylymantria disparjapanese red armyinky-cap mushroomhyponitrous acidhypogastric veingenus syrrhaptesgenus pyracanthagenus pterocaryagenus pternohylagenus psychotriagenus porphyrulagenus polybotryagenus polybotriagenus phylloxeragenus phrynosomagenus paronychiagenus lactophrysgenus hyphantriagenus cystophoragenus cerapteryxgarden symphilidfrench polynesiaeucalypt grandisdaisy print wheelcondylar processbypass condenserbroadly speakingaversion therapyapyretic tetanusapparel industryanal personalityallegheny spurgeagropyron repens
