15-Letter Words Containing: P,L,E,N,I,S,H
(In Any Order)
There are 96 15 letter words,
71 15 letter phrases and
0 15 letter abbr's with
P,L,E,N,I,S,H in.
Best Scoring
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| hydroxyprolines | 15 | 34 | nounn | |||||
noun • a crystalline amino acid obtained from gelatin or collagen | ||||||||
| chlorpromazines | 15 | 33 | noun, adjectiven, adj | |||||
noun • a drug (trade name Thorazine) derived from phenothiazine that has antipsychotic effects and is used as a sedative and tranquilizer | ||||||||
| psychogenically | 15 | 31 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| comprehensively | 15 | 30 | adverbadv | |||||
adverb • in an all-inclusive manner | ||||||||
| rehospitalizing | 15 | 30 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| nonhospitalized | 15 | 30 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| hypervigilances | 15 | 29 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| epithelizations | 15 | 29 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| accomplishments | 15 | 28 | nounn | |||||
noun • the action of accomplishing something • an ability that has been acquired by training | ||||||||
| phthalocyanines | 15 | 28 | nounn | |||||
noun • Any of a family of macrocyclic compounds having a structure similar to that of porphyrin; they are blue/green pigments that are used in plastics and enamels. | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 15 Letter Words
Words (96)
neurophysiologyplainclothesmancomprehensivelyhypervigilanceshypersalivationchlorpromazinesaccomplishmentssteeplechasingssprightlinessesrehospitalizingradiotelephonespunishabilitiespsychogenicallypreestablishingplainclothesmenphthalocyaninesphenylthioureasphenomenologistphenomenologiesphenomenalisticpharisaicalnesspantheisticallynonphilosophersnonhospitalizedlymphadenitisesionosphericallyinhospitalitieshyperventilateshypersalinitieshyperinsulinismhyperinflationshydroxyprolinesepithelizationsencephalitogenscontrollershipschancellorshipsvideotelephonesunapprehensibletriphenylaminestrinitrophenolssulphinpyrazonesulphanilamidesstegocephalianssplanchnologiessphericalnessesselenographistsselenographicalrhinencephalonsrehospitalisingpsychogeneticalpolysynthetismspolysyntheticalpolysynthesismsphotoluminescesphotoluminescedphenomenalitiesphenomenalisingphantasmalitiesphallocentrismspamphleteeringsornithodelphousnonhospitalisedmacrencephaliesmacrencephaliaslissencephalouslieutenantshipslicentiateshipsirreprehensiblyirreprehensibleinapprehensiblehypocrystallinehyperpolarisinggraphicalnessesepithelisationsepithelialisingencephalotomiesdisplenishmentsdiphenylketonesdesulphurationscounsellorshipschamberlainshipbalneotherapiesanthropolatriesalexipharmakonsplatyhelminthespinkish-lavenderpanencephalitisnephrosclerosisnephrolithiasismephistophelianmephistopheleanhyperadrenalismflemish-speakingenglish-speakingctenocephalidesalphabetisationPhrases (71)
whispering bellsspanish languagepolyphonic proseneedle spike rushgenus phalangiumgenus pagophilusgenus gnaphaliumgenus geothlypisgenus delphiniumcivil censorshipbelgian shepherdwindshield wiperwestern whiptailstapling machinespring vetchlingsplanchnic nervesphincter musclespelling checkerspanish mackerelspanish lime treeslip of the tonguesleeping draughtsir philip sidneysenile psychosissalmonella typhipull in one's hornspublishing houseplectognath fishphysical sciencephysical fitnesspholis gunnellusphenolic plasticphase modulationpencil sharpenermitchella repensmesophytic plantmechanical presslappish languagein the first placeherpes genitalisgenus sitophylusgenus sceliphrongenus salpichroagenus pollachiusgenus polianthesgenus pholistomagenus phlebodiumgenus lophosoriagenus lepechiniagenus hypsiglenagenus helipterumgenus heliophilagenus gypsophilagenus epiphyllumgenus drosophilagenus chlorophisgenus chimaphilagenus calliphoragenus calliophisgarden symphilidfriendship plantfrench polynesiaesophageal veinsenglish springerenglish primroseenglish plantaindaisy print wheelcreeping thistleblenheim spanielblechnum spicantbelgian sheepdog
