Dictionary Only:
Profanity Off:

15-Letter Words Containing: P,H,E,L,_

 (In Any Order)
There are 398 15 letter words, 257 15 letter phrases and 0 15 letter abbr's with P,H,E,L,_ in.

Best Scoring 15 Letter Words With: P,H,E,L,_

Expand?WordSave?LengthUsagePointsType
phytochemically15
35 adverb, adjectiveadv, adj
Valid word for Scrabble US
hyperpolarizing15
35 adjectiveadj
Valid word for Scrabble US
psychosexuality15
35 noun, adjectiven, adj
noun

• the mental representation of sexual activities

hexachlorophene15
35 noun, adjectiven, adj
noun

• antibacterial substance that is a water-soluble powder used in antiseptic soaps and toothpaste

lymphadenopathy15
34 nounn
noun

• chronic abnormal enlargement of the lymph nodes (usually associated with disease)

hydroxylapatite15
34 nounn
Valid word for Scrabble US
psychochemicals15
34 nounn
Valid word for Scrabble US
plethysmography15
34 nounn
Valid word for Scrabble US
phenylbutazones15
34 nounn
noun

• anti-inflammatory drug (trade name Butazolidin)

hydroxyprolines15
34 nounn
noun

• a crystalline amino acid obtained from gelatin or collagen

or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 15 Letter Words

Words (398)
lymphadenopathyelectrophoresisdolichocephalicparentheticallytherapeuticallyneurophysiologyphotomultiplierplainclothesmanmethylphenidateencephalographychloramphenicoldemographicallysympatheticallypalaeopathologyeuphemisticallyphenolphthaleincomprehensivelyrhombencephalonimperishabilitybiogeographicalamphitheatricalacanthocephalanuncopyrightablesophisticatedlyreproachfulnesspsychedelicallypolysaccharidesphotoduplicatedmetallographieshypervigilanceshyperstimulateshyperstimulatedhypersomnolencehypersalivationhyperfunctionalhypercoagulablehydroxylapatiteepitheliomatousepithelializingelectrophoresedchlorpromazinesblasphemousnessaccomplishmentszoogeographicalxerographicallysteeplechasingsstadtholdershipsprightlinessesshapelessnessesrehospitalizingradiotelephonesradiotelegraphspyrotechnicallypunishabilitiespsychogenicallypsychochemicalspsychobiologiesprehistoricallypreestablishingplethysmographyplethysmographsplatyhelminthicplainclothesmenphytoflagellatephytochemicallyphthalocyaninesphotogeologistsphotogeologicalphotoelectronicphotoduplicatesphotodegradablephotochemicallyphosphorylativephenylthioureasphenylketonuricphenylbutazonesphenomenologistphenomenologiesphenomenalisticpharmaceuticalspharisaicalnessperishabilitiespantheisticallypaleogeographicosteopathicallyoscillographiesophthalmoscopesophthalmologiesoceanographicalnucleophilicitynonphilosophersnonmetaphoricalnonhospitalizedneuropathologicneuropathicallymicropublishersmetamorphicallymetallographersmegasporophyllslymphadenitiseslegislatorshipsionosphericallyinterphalangealinhospitalitieshyperventilateshyperventilatedhypervelocitieshypersalinitieshyperpolarizinghypermutabilityhypermobilitieshypermetabolismhyperlipidemiashyperinvolutionhyperinsulinismhyperinflationshypercriticallyhypercatabolismhydroxyprolineshydrocephaluseshomeopathicallygeostrophicallygeomorphologistgeomorphologiesepithelizationsepiphenomenallyepichlorohydrinencephalopathicencephalographsencephalitogenselectrophoresesecophysiologiesdephosphorylatecontrollershipschlorpropamideschancellorshipscephalothoraxescephalothoracesbrachycephaliesbibliotherapiesatmosphericallyamphidiploidiesallelomorphismstelephotographytelegraphicallyradiotelegraphypsychosexualityphysicochemicalphototelegraphyphotometricallyphotomechanicalphenylketonurianeuropsychologylexicographicalideographicallyhypercatalectichexachloropheneelectrophoreticelectromyographdermatoglyphicscomptrollershipalphabetizationlymphocytosiseszygophyllaceouszoopsychologieszoophysiologiesxenomorphicallyvideotelephonesunapprehensibletriphenylaminestrinitrophenolsthoracoplastiestheosophisticalthalassotherapythalassographerthalamencephalatelephotographstelautographiessymbolographiessyllabographiessulphureousnesssulphonmethanessulphinpyrazonesulphathiazolessulphanilamidessulphacetamidesstrephosymboliastratosphericalstereographicalstegocephaliansstadholdershipssplanchnologiessphericalnessessphaerocrystalsspeleotherapiesspeechfulnessessesquisulphidesselenographistsselenographicalseismographicalscaphocephalousscaphocephalismscaphocephaliesrhinencephalonsrehospitalisingpulmobranchiatepterylographiespteridophilistspsychrometricalpsychogeneticalpsychodelicallypsychoanalyzerspsychoanalyserspsephologicallypolysynthetismspolysyntheticalpolysynthesismspolysaccharosespolyphloesboeanpolychloroprenepolychlorinatedpoikilothermismpoikilothermiesplagiocephaliesphyllosilicatesphrenologicallyphototelegraphsphotoluminescesphotoluminescedphotoelectrodesphotoelasticityphlebosclerosisphlebosclerosesphilosophastersphenomenalizingphenomenalitiesphenomenalisingphantasmalitiesphallocentrismspetrochemicallyperoxysulphuricperityphlitisesperipheralitiesperchloroetheneparaheliotropicpamphleteeringspalaeophytologypalaeontographypalaeographistspalaeographicalpalaeoethnologypalaeoanthropicornithodelphousornithodelphianophthalmometersnonhospitalisednephroblastomasmyelencephalonsmicroaerophilicmicroaerophilesmetallographistmesaticephalousmesaticephaliesmegalocephalousmegalocephaliesmacrencephaliesmacrencephaliaslymphoadenomatalophobranchiatelissencephalouslipodystrophieslieutenantshipslicentiateshipslexicographistsirreprehensiblyirreprehensibleinapprehensiblehypsometricallyhypoventilationhypocrystallinehyperpolarisinghyperphysicallyhypermetropicalhyperglycaemiashypercalcaemiashouseholdershiphistocompatiblehexachlorophaneheterographicalhepaticologistshepaticologicalheliotropicallyheliosciophyteshalfpennyworthsgraphicalnessesgoodfellowshipsepithelisationsepithelialisingephemeralnessesencephalotomieseleutherophobiceleutherophobiaelectrophoruseselectrographiesedriophthalmousedriophthalmiandisplenishmentsdiphenylketonesdiphenyleniminediaheliotropismdesulphurationsdephlogisticatedecipherabilitydactylographiesdactylographerscytopathologiescounsellorshipsclimatographieschemotropicallychemolithotrophchamberlainshipcephalothoracicbrachycephalousbrachycephalicsbrachiocephalicbiopsychologiesbalneotherapiesapheliotropismsanthropolatriesalexipharmakonsaerohydroplanestrachelospermumthalmencephalonsphaerocarpalessphaerobolaceaescrophularialesrhynchocephaliaradiotelephonicprotoarcheologypropionaldehydeprechlorinationpre-raphaelitismpoikilothermousplatyhelminthesplatycephalidaepinkish-lavenderphyllocladaceaephotoheliographphotoelectricalphiladelphaceaephenylacetamidepentaerythritolparathelypterispanencephalitispaleornithologypaleoencephalonpalaeogeographypalaeencephalonophthalmoplegiaophioglossaceaeneuroepitheliumnephrosclerosisnephrolithiasismephistophelianmephistopheleanmarginocephaliamacrencephalouslymphocytopenialymphoblast-likehypocellularityhyperlipoidemiahyperlipidaemiahypercalcinuriahyperadrenalismhydrophyllaceaehourglass-shapedhippoglossoideshighly-developedgorgonocephalusgasterophilidaeflemish-speakingenglish-speakingelectrophoridaectenocephalideschloroplatinatecephalotaxaceaecephalohematomacephalochordatecephalochordatacaryophyllaceaebutterfly-shapedbrachycephalismaphyllophoralesaphyllanthaceaeangiohemophiliaalphabetisationalpha-tocopheralalpha-interferon
Phrases (257)
whited sepulchrewhited sepulcherwhispering bellsvena ophthalmicasparkplug wrenchspanish languageseychelles rupeeschool newspaperscholarly personrepublic of ghanapsychotic beliefpsychedelic drugpolyphonic prosepolitical spherephysical processpersonal chattelpahlavi languageorder lagomorphanephelium litchineedle spike rushmechanical pianolymphatic vesseljoseph priestleyjohnny appleseedjacques lipchitzimperial mammothhumphrey gilberthomework problemhistorical paperheart specialisthakea leucopteragraphical recordgenus phascogalegenus phalangiumgenus pagophilusgenus lophodytesgenus hyalophoragenus gnaphaliumgenus geothlypisgenus delphiniumgenus asphodelusfamily lophiidaefamily aphididaecivil censorshipchemical processchechen republiccall on the carpetcalcium sulphatebelgian shepherdalpha methyl dopaadhesive plasterxerophytic plantwitch hazel plantwindshield wiperwhite dipladeniawhistle-stop tourwestern whiptailwaterwheel planttightrope walkerthymus serpyllumtemporal canthusteletype machinetelescopic sighttelephone systemtelephone numbersulphur bacteriastephen jay gouldstephen a. douglasstapling machinespruce gall aphidspring vetchlingspore mother cellsplanchnic nervesphincter musclespelling checkerspeak of the devilspanish mackerelspanish lime treeslough of despondslopseller's shopslip of the tonguesleeping draughtsir philip sidneyseriphus politussenile psychosisschizaea pusillasan carlos apachesalvia spathaceasalmonella typhirepublic of haitirepublic of chinarepublic of chilepygmy sperm whalepurple milk vetchpull in one's hornspublishing housepsychodelic drugpsychedelic rockpsephurus gladispropenyl alcoholpolyhedral anglepolitical theorypliny the youngerplectognath fishphysical therapyphysical sciencephysical fitnessphylum nemertinapholis gunnellusphillis wheatleyphilippine cedarphenolic plasticphaseolus aureusphase modulationperu-chile trenchpencil sharpenerpehlevi languagepearly razorfishpeachleaf willowpathetic fallacyparticle physicsparker house rollorder sphagnalesorder phalangidaorder mallophaganemophila auritamitella diphyllamitchella repensmesophytic plantmechanical pressmechanical powermaxfield parrishmarco polo's sheepmalpighian layerlymphatic tissuelymphatic systemlow beam headlamplinotype machinelight microscopelepiota rhacodeslegal philosophylarge tooth aspenlappish languagelady with the lampkepler's third lawjinghpo languagejack-in-the-pulpitiron perchloridein the first placeice-hockey playerhughes telegraphhubble parameterhualpai languagehordeum pusillumholy roman empirehoheria populneaherpes genitalisherbaceous planthebraic alphabethairy darling peagreen apple aphidgrape phylloxeragospel of matthewgolfo de campechegolden parachutegolden chinkapingenus tachypleusgenus sitophylusgenus sceliphrongenus salpichroagenus pternohylagenus porphyrulagenus pollachiusgenus polianthesgenus phytolaccagenus phylloxeragenus phyllodocegenus pholistomagenus phlebodiumgenus phalaropusgenus omphalotusgenus melophagusgenus lophosoriagenus lophophoragenus lepechiniagenus lactophrysgenus hypsiglenagenus hylophylaxgenus helipterumgenus heliophilagenus halocarpusgenus gypsophilagenus epiphyllumgenus drosophilagenus chlorophisgenus chimaphilagenus cephalotusgenus calliphoragenus calliophisgenus boselaphusgenus aspalathusgenus alcelaphusgarden symphilidfriendship plantfrench telephonefrench polynesiaflying phalangerflavius josephusfamily ziphiidaefamily xiphiidaefamily typhaceaefamily thripidaefamily sphecidaefamily phyllidaefamily phillidaefamily phasmidaefalse beachdropsexplosive chargeeuphorbia pepluseuphorbia litchiesophageal veinsesophageal smearepiscopal churchepidemic choleraenglish springerenglish primroseenglish plantaindwarf sperm whaledepth psychologydental handpiecedaisy print wheelcreeping thistlecreeping charliecomposite schoolcocopah languageclass polychaetachingpo languagechelate compoundchappe telegraphchannel capacitycelestial spherecargo helicoptercadmium sulphidebromophenol blueblenheim spanielblechnum spicantbleaching powderbell-shaped curvebelgian sheepdogbattle of sempacharmillary spherearapaho languageapostelic fatheranthony trollopealpine milk vetchallegheny spurgeafrican elephant
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen