Dictionary Only:
Profanity Off:

15-Letter Words Containing: P,E,N,D

 (In Any Order)
There are 300 15 letter words, 305 15 letter phrases and 0 15 letter abbr's with P,E,N,D in.

Best Scoring 15 Letter Words With: P,E,N,D

Expand?WordSave?LengthUsagePointsType
benzodiazepines15
38 nounn
noun

• any of several similar lipophilic amines used as tranquilizers or sedatives or hypnotics or muscle relaxants; chronic use can lead to dependency

lymphadenopathy15
34 nounn
noun

• chronic abnormal enlargement of the lymph nodes (usually associated with disease)

hydroxyprolines15
34 nounn
noun

• a crystalline amino acid obtained from gelatin or collagen

hypersensitized15
33 adjectiveadj
adjective satellite

• having an allergy or peculiar or excessive susceptibility (especially to a specific factor)

underemphasized15
33 adjectiveadj
adjective

• Insufficiently emphasized

haphazardnesses15
33
noun

• the quality of lacking any predictable order or plan

adenohypophysis15
32 nounn
noun

• the anterior lobe of the pituitary body; primarily glandular in nature

underemphasizes15
32 verbv
verb

• To place insufficient emphasis on.

underpublicized15
32 adjectiveadj
Valid word for Scrabble US
adenohypophyses15
32 nounn
noun

• the anterior lobe of the pituitary body; primarily glandular in nature

or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 15 Letter Words

Words (300)
underprivilegedunsophisticatedlymphadenopathydevelopmentallypseudoephedrineuninterruptedlypolyunsaturatedmethylphenidatejurisprudentialunprecedentedlyinterdependencedispassionatelycorrespondinglyuncomprehendinginterdependencydiphenhydraminesuperintendencesidesplittinglyperpendicularlyhypersensitizedexpeditiousnesscomplicatednessadenohypophysisacetophenetidinunderemphasizesunderemphasizedunchoreographedsuperintendentssuperabundantlyserendipitouslypseudoscientistpremanufacturedprekindergartenpredispositionspredestinarianspreadolescencespigheadednessesphotosensitizedoverrepresentedopenmouthednessopenheartednessmultidisciplinemisapprehendingimponderabilitydisproportioneddisappointmentsdescriptivenessdepartmentalizedecompensationsdeceptivenessescyproheptadinescompendiousnessbenzodiazepinesaminopeptidasesradioprotectionphotoconductiveunderpublicizedunderemploymentunanticipatedlytransparentizedsuperintendencysuperinductionssuperindividualsuperheterodynesuperconductorssuperconductivesuperconductingsupercalenderedsuperabundancessubdevelopmentssplendiferouslyseptendecillionrepudiationistsradiotelephonespseudoscorpionspseudopregnancypseudepigraphonproletarianizedproletarianisedprepresidentialpreponderationspreponderanciespremodificationprejudicialnesspredestinationspreconditioningpostdevaluationpossessednessesponderousnessespolynucleotidesplatinocyanidespinheadednessespinealectomizedphotoreductionspervertednessespendulousnessesparadoxicalnessoverproductionsoveropinionatedoverdevelopmentoverdependencesovercompensatedopinionatednessnonreproductivenonindependencenonhospitalizednonencapsulatednondevelopmentsnondepartmentalnoncomputerizedmisdescriptionslymphadenitisesinterpenetratedindisciplinablehypochondriaseshyperventilatedhyperproductionhypermodernistshydroxyprolineshaphazardnessesgrandparenthoodfibrinopeptidesexpendabilitiesexpandabilitiesepichlorohydrinendoparasitismsdisparatenessesdesperatenessesdepolarizationsdepigmentationsdepersonalizingdependabilitiesdaguerreotypingcounterpicketedcorrespondencesantidevelopmentantidepressantsadenohypophysesunderproductiondessertspoonfulboustrophedonicsuperencipheredpredevaluationspostadolescentsnonreproducibleantidepressionsvideotelephonesvespertilionidsunsuspectednessunspottednessesunspiritualizedunspiritualisedunpremeditationunpractisednessundisciplinableunderpublicisedunderperformingunderemphasisesunderemphasisedunderdevelopingundercapitalizeundercapitalisetransportednesstransparentisedsuspectednessessuperordinatingsuperinducementsuperconfidencesuperconductionsuperadditionalsulphanilamidesstilpnosideritespheroidizationspheroidisationsimplicidentatescolopendriformpyknodysostosespycnodysostosespseudosolutionspseudomembranesprudentialitiespredictablenesspredevelopmentspredeterminismspredeterminablepredesignationspredatorinessesponderabilitiespolyvinylidenespolychlorinatedplatitudinizersplatitudiniserspinealectomisedphotosensitisedphotoluminescedperplexednessesperiodontitisesperiodonticallyperfervidnessespentadactylismspedestrianizingpedestrianisingpedagoguishnessornithodelphousornithodelphiannonhospitalisednondescriptnessnoncomputerisedmonophthongizedmonophthongisedmisproportionedmiscomprehendedlymphoadenomatalepidodendroidsinterpunctuatedimpassionednessergatandromorphequiponderatingequiponderancesepicondylitisesendocrinopathicencyclopaedistsencyclopaedismsedriophthalmiandurchkomponiertdisputativenessdisplenishmentsdispleasingnessdispersednessesdisincorporatesdisincorporateddisimprisonmentdisempowermentsdiphenylketonesdiphenyleniminedexamphetaminesdesulphurationsdepolarisationsdepersonalisingdepartmentalismdepartmentalisedehypnotizationdehypnotisationcyclopentadienecounterpleadingcorrespondentlycomplexednessescompactednessescinematographedchondrophorineschenopodiaceousbespottednessesapprenticehoodsappendicularianandrogynophoresaerohydroplanesadaptablenessesunprotectednessundependabilityuncompartmentedtorpediniformessupersensitizedsupersensitisedsuperordinationstenopelmatidaeself-opinionatedself-disciplinedself-descriptionself-deprecatingradiotelephonicradio-gramophonepseudomonadalespropionaldehydeprice-controlledpinkish-lavenderphenylacetamidephenazopyridinepetromyzontidaepaleodendrologymanic-depressivelow-spiritednesslepidodendraleskannada-speakingill-proportionedhypersensitisedhyperadrenalismhearing-impairedgenus-megapodiusentandrophragmadispensablenessdecompositionalcyprinodontidaectenocephalidescryptacanthodesclosed-captionedceratopogonidaebrownish-stripedbalaenopteridaeantheridiophoreacademicianship
Phrases (305)
windscreen wiperunskilled personsuprarenal glandstate departmentstars and stripesstandup comedianspreading factorspiny-headed wormsound perceptionslender lady palmsingapore dollarscorpaenoid fishprunus domesticapresident wilsonpresident hooverpresident carterpour cold water onpoitrine d'agneaupigeon droppingsphyseter catodonpanel discussionorder sapindalesneedle spike rushmedulla spinalismedicare paymentluigi pirandellolong-clawed prawnlocal departmentlabor departmentjuan ponce de leonjohnny appleseediridaceous plantintravenous dripindependence dayguy de maupassantgreen peach aphidgenus priodontesgenus podocarpusgenus lycoperdongenus lophodytesgenus epidendrumgenus dipladeniagenus delphiniumgenus dasyproctagenus aspidiotusgenus asphodelusgenus ailuropodadisplaced persondispersing phasediospyros ebenumdepartment storedental appliancedementia praecoxdaphne du maurierdanaus plexippuscurlew sandpipercultivated plantcoronoid processcomputing devicecaudal appendagecapital of swedencapital of nevadacampanula mediumbuilding complexbirthday presentbelgian shepherdascidian tadpoleairplane landingadiantum pedatumacer platanoideswindward passagewindshield wiperwhitebarked pinewhite snapdragonwhite dipladeniaupland sandpiperundirected graphtrain dispatchertrade protectiontrade acceptancetongue depressortax depreciationtasman dwarf pinetarquin the proudtappan zee bridgesynapsid reptilesustaining pedalsuperoxide anionstudio apartmentstriped muishondstephen sondheimstephen jay gouldstephen a. douglassteel productionspiny-finned fishspecial pleadingsound projectionsnowdrop anemoneslough of despondslender knapweedsleeping draughtsir philip sidneysingapore islandseward peninsulasales departmentround-trip ticketrepublican guardrepublic of indiapush-down storagepunitive damagespulse modulationpudding pipe treepublic knowledgeprunus sieboldiiproduction orderprivet andromedapresident trumanpresident taylorpresident reaganpresident piercepresident monroepresident arthurpredatory animalpraetorian guardpowder techniqueportmanteau wordpope benedict xivpope alexander vipond bald cypresspolyhedral anglepolar coordinateplayground slideplant departmentplains spadefootpinus densiflorapinus cembroidespink sand verbenapin-tailed grousepiedmont glacierphilippine cedarphase modulationpermanganic acidpericardial veinperformance bondpeppermint candypenstemon doliuspencil cedar treepecten irradiansparts departmentpantothenic acidpanduriform leafpainted tortoisepainted terrapinorder sphagnalesorder phalangidaorder pandanalesorder opuntialesorder neuropteraoperating budgetold-age pensionerodontoid processnymphaea odoratanord-pas-de-calaisnewspaper editornew world sparrowneuroleptic drugmusic departmentminiature poodlemenopon palladummeat and potatoesmanic depressionlunar time periodlobed spleenwortline-drive triplelegal proceedinglearned responseland developmentkorean lespedezakippered herringjohn hoyer updikejapanese red pinejapanese red armyjapanese islandsisland dispenseriron perchlorideinterrupted ferninfrared therapyhigh-protein dietheat dissipationhairy darling peaguadalupe islandgroundwater pumpgreen woodpeckergreen apple aphidgreater knapweedgreat depressiongraphic designergrade separationgolden parachutegolden chinkapinglandular plaguegestation periodgerman police doggenus spodopteragenus scindapsusgenus pylodictusgenus pseudechisgenus pseudacrisgenus pontederiagenus pomaderrisgenus polypodiumgenus podilymbusgenus plasmodiumgenus piptadeniagenus phyllodocegenus phlebodiumgenus peridiniumgenus pedionomusgenus odontaspisgenus lycopodiumgenus hyperoodongenus hippodamiagenus dryopterisgenus drosophilagenus dipteroniagenus diplotaxisgenus diplodocusgenus dimocarpusgenus dendraspisgenus decapterusgenus conopodiumgenus carpodacusgenus aspidistragenus aspidelapsgenus aplodontiagenus andropogongarden symphilidgarden centipedefringed polygalafriendship plantflying drainpipefield pennycressfamily cynipidaeezra loomis poundevoked potentialeuropean wildcateucalypt grandisequine distemperects-credit pointdyadic operationdwarf nipplewortduplex apartmentdrop in the bucketdrooping juniperdowny woodpeckerdouble pneumoniadomestic partnerdobereiner's lampdipterous insectdiapensia familydiane de poitiersdependent clausedeparture loungedental proceduredental handpiecedeficit spendingdeferred paymentdata input devicedaisy print wheelcyperus rotunduscotes de provenceconsumption weedcondylar processcompound proteincommon speedwellclass gnetopsidachelate compoundchardonnay grapecarduelis spinuscapetian dynastycapeline bandagecape sable islandcanine distempercandlepower unitcanadian red pinecanada porcupinebypass condenserbuffered aspirinbroadly speakingborder patrolmanbleaching powderbigtoothed aspenbig-toothed aspenbidens bipinnatabenzoyl peroxidebelladonna plantbelgian sheepdogbaruch de spinozabanded palm civetasplenium virideapparel industryamerican red plumalpine goldenrodabasia trepidansabandoned person
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen