Dictionary Only:
Profanity Off:

15-Letter Words Containing: L,P,H,I

 (In Any Order)
There are 440 15 letter words, 225 15 letter phrases and 0 15 letter abbr's with L,P,H,I in.

Best Scoring

Expand?WordSave?LengthUsagePointsType
psychoanalyzing15
38 verb, adjectivev, adj
verb

• subject to psychoanalytic treatment

hypnotizability15
37 nounn
Valid word for Scrabble US
phytochemically15
35 adverb, adjectiveadv, adj
Valid word for Scrabble US
hyperpolarizing15
35 adjectiveadj
Valid word for Scrabble US
psychosexuality15
35 noun, adjectiven, adj
noun

• the mental representation of sexual activities

hydroxylapatite15
34 nounn
Valid word for Scrabble US
psychochemicals15
34 nounn
Valid word for Scrabble US
hydroxyprolines15
34 nounn
noun

• a crystalline amino acid obtained from gelatin or collagen

physicochemical15
34 adjectiveadj
adjective

• relating to physical chemistry

chlorpromazines15
33 noun, adjectiven, adj
noun

• a drug (trade name Thorazine) derived from phenothiazine that has antipsychotic effects and is used as a sedative and tranquilizer

or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 15 Letter Words

Words (440)
psychologicallyophthalmologisthospitalizationphotojournalistphysiologicallyphilosophicallyanthropologicalelectrophoresisdolichocephalicpharmacologicalphotojournalismpsychobiologistparentheticallytherapeuticallyhospitalisationneurophysiologyphotomultiplierpulchritudinousplainclothesmanmethylphenidatehypochondriacalchloramphenicoldemographicallysympatheticallyeuphemisticallypsychiatricallyphenolphthaleincomprehensivelyimperishabilitybiogeographicalbibliographicalapproachabilityamphitheatricaluncopyrightablethromboplastinssycophanticallysophisticatedlypsychoanalyzingpsychedelicallypolysaccharidesphysiographicalphotoduplicatedphilanthropistsphilanthropicalmetallographieshypervigilanceshyperstimulateshyperstimulatedhypersalivationhyperfunctionalhydroxylapatiteepitheliomatousepithelializingchlorpromazinesautotrophicallyaccomplishmentszoogeographicalxerographicallysteeplechasingsstadtholdershipsprightlinessessaprophyticallyrehospitalizingradiotelephonesradiotelegraphspyrotechnicallypunishabilitiespsycholinguistspsychogenicallypsychochemicalspsychobiologiesprehistoricallypreestablishingpolymorphicallyplatyhelminthicplainclothesmenphytoplanktonicphytochemicallyphysiopathologyphthalocyaninesphototropicallyphototacticallyphotogeologistsphotogeologicalphotoelectronicphotoduplicatesphotochemicallyphotobiologistsphotobiologicalphosphorylativephosphorylationphosphorylatingphonogramicallyphilanthropoidsphenylthioureasphenylketonuricphenomenologistphenomenologiesphenomenalisticpharmacologistspharmaceuticalspharisaicalnessperishabilitiespathophysiologypantheisticallypaleogeographicosteopathicallyoscillographiesophthalmoscopicophthalmologiesoceanographicalnucleophilicitynonphilosophersnonmetaphoricalnonhospitalizednonbiographicalneuropathologicneuropathicallymicropublishingmicropublishersmicrophysicallymicromorphologymetamorphicallylyophilizationslymphangiogramslymphadenitiseslogographicallylegislatorshipsionosphericallyinterphalangealinhospitalitieshypnotizabilityhyperventilateshyperventilatedhypervelocitieshypersalinitieshyperpolarizinghypermutabilityhypermobilitieshypermetabolismhyperlipidemiashyperinvolutionhyperinsulinismhyperinflationshypercriticallyhypercatabolismhydroxyprolineshomeopathicallyholographicallyhistophysiologyhistopathologicgeostrophicallygeomorphologistgeomorphologiesepithelizationsepiphenomenallyepichlorohydrinencephalopathicencephalitogensecophysiologiesdiastrophicallycouncillorshipscontrollershipsconsultantshipsclaustrophobiaschlorpropamideschancellorshipsbrachycephaliesbibliotherapiesautographicallyatmosphericallyastrophysicallyantisyphiliticsantishopliftinganthropologistsamphidiploidiesallelomorphismsachondroplasiastypographicallytopographicallytelegraphicallyradiotelegraphypsychosexualityphysicochemicalphotometricallyphotomechanicalphotolithographphenylketonuriamorphologicallymicrosporophylllexicographicalimmunopathologyideographicallyhypercatalecticelectrophoreticdermatoglyphicscomptrollershipcholangiographyalphabetizationachondroplasticlymphocytosiseszoopsychologieszoophytologistszoophytologicalzoophysiologistzoophysiologiesxylotypographicxenomorphicallyvideotelephonesunphilosophicalunapprehensibletriphenylaminestrinitrophenolsthoracoplastiestheosophisticalthalassographictelautographiessymbolographiessyllabographiessulphurizationssulphurisationssulphinpyrazonesulphathiazolessulphanilamidessulphacetamidesstrephosymboliastratosphericalstratigraphicalstigmatophiliststigmatophiliasstereographicalstegocephaliansstaphyloplasticstadholdershipssplanchnologiessphericalnessesspeleotherapiessesquisulphidesselenographistsselenographicalseismographicalscaphocephalismscaphocephaliesrhinencephalonsrehospitalisingradiophonicallypulmobranchiatepterylographiespteridophilistspsychrometricalpsychographicalpsychogeneticalpsychodelicallypsychoanalysingpsilanthropistspsilanthropismspsephologicallyprolocutorshipspolysynthetismspolysyntheticalpolysynthesismspolygraphicallypolychromatismspolychlorinatedpoikilothermismpoikilothermiesplagiocephaliesphyllosilicatesphrenologicallyphotoluminescesphotoluminescedphotoelasticityphlogisticatingphlebosclerosisphilosophastersphenomenalizingphenomenalitiesphenomenalisingpharyngologistspharyngologicalpharmacopolistsphantasmalitiesphantasmagorialphallocentrismspetrochemicallyperoxysulphuricperityphlitisesperipheralitiespatriarchalismsparaheliotropicparagraphicallypanophthalmitispamphleteeringspalaeographistspalaeographicalpalaeoanthropicornithodelphousornithodelphianorganographicalophthalmophobianonhospitalisednomographicallymonographicallymicroaerophilicmicroaerophilesmetallographistmesaticephalousmesaticephaliesmegalocephaliesmacrencephaliesmacrencephaliaslyophilisationslophobranchiatelithontriptistslithonthrypticslissencephalouslipodystrophieslieutenantshipslicentiateshipslexicographistsirreprehensiblyirreprehensibleinapprehensibleidiomorphicallyhypsometricallyhypoventilationhypocrystallinehypnotisabilityhyperpolarisinghyperphysicallyhypermetropicalhyperglycaemiashypercalcaemiashygroscopicallyhydrotropicallyhydropathicallyhouseholdershiphomoplasticallyhistocompatibleheterographicalhepaticologistshepaticologicalheliotropicallyheliosciophytesgraphicalnessesgramophonicallygoodfellowshipsglyptographicalglyphographicalglossographicalepithelisationsepithelialisingencephalotomieseleutherophobiceleutherophobiaelectrographiesedriophthalmousedriophthalmiandisplenishmentsdiphenylketonesdiphenyleniminediaheliotropismdesulphurationsdephlogisticatedecipherabilitydactylographiescytopathologiescounsellorshipsclimatographieschemotropicallychemolithotrophchartographicalchaptalizationschaptalisationschamberlainshipchalcographistschalcographicalcephalothoraciccardiographicalbronchoscopicalbrachycephalicsbrachiocephalicbiopsychologiesbibliophilisticbalneotherapiesautomorphicallyapheliotropismsantiphlogisticsanthropolatriesanthropobiologyallotriomorphicalexipharmakonsscrophularialesrhynchocephaliaradiotelephonicptilonorhynchuspropionaldehydeprechlorinationpre-raphaelitismpoikilothermousplatyhelminthesplatycephalidaepinkish-lavenderphotoheliographphotoelectricalphiladelphaceaephenylacetamidepentaerythritolparathelypterispanencephalitispaleornithologyophthalmoplegiaophioglossaceaeneuroepitheliumnephrosclerosisnephrolithiasismephistophelianmephistopheleanmarginocephalialymphocytopenialymphoblast-likehypocellularityhyperlipoidemiahyperlipidaemiahypercalcinuriahyperadrenalismhippoglossoideshighly-developedgasterophilidaeflemish-speakingenglish-speakingelectrophoridaectenocephalidescryptographicalchloroplatinatebrachycephalismbalanoposthitisangiohemophiliaalphabetisationalpha-interferon
Phrases (225)
whited sepulchrewhited sepulcherwhispering bellsvena ophthalmicaspanish languageschool principalrepublic of ghanapsychotic beliefpsychedelic drugpolyphonic prosepolitical spherephysical processphysical contactphysical abilitypahlavi languagenephelium litchineedle spike rushmechanical pianolymphatic vessellight adaptationlanding approachjoseph priestleyjacques lipchitzimperial mammothhumphrey gilberthonduran capitalhistorical paperheart specialisthawaiian capitalgraphical recordgenus phalangiumgenus pagophilusgenus gnaphaliumgenus geothlypisgenus delphiniumfamily lophiidaefamily aphididaeclass ciliophoracivil censorshipchemical processchechen republiccapital of hawaiicaltha palustriscalcium sulphatebelgian shepherdautophytic plantalto saxophonistadhesive plasterxerophytic plantwitch hazel plantwindshield wiperwilliam thompsonwhite dipladeniawhistle-stop tourwestern whiptailtyphoid bacillustightrope walkerteletype machinetelescopic sightsulphur bacteriasulphanilic acidstapling machinespruce gall aphidspring vetchlingsplanchnic nervesphincter musclespelling checkerspeak of the devilspanish psylliumspanish mackerelspanish lime treespanish civil warslip of the tonguesleeping draughtsir philip sidneyseriphus politussenile psychosisschizaea pusillasalvia spathaceasalmonella typhirepublic of haitirepublic of chinarepublic of chileralph richardsonpyrophoric alloypurple milk vetchpull in one's hornspublishing housepsychodelic drugpsychedelic rockpsephurus gladisprimary syphilispopulation shiftpolyphonic musicpolitical theorypliny the youngerplectognath fishpinus monophyllaphysical therapyphysical sciencephysical fitnessphysalis viscosaphylum sipunculaphylum phoronidaphylum nemertinapholis gunnelluspholiota flavidaphillis wheatleyphilippine cedarphilip ii of spainphenolic plasticphase modulationphantom limb painperu-chile trenchpencil sharpenerpehlevi languagepearly razorfishpeachleaf willowpathetic fallacyparticle physicsparochial schoolorder phalangidanemophila auritamoral philosophymitella diphyllamitchella repensmesophytic plantmechanical pressmechanical powermaxfield parrishmalpighian layermalpighia glabralymphatic tissuelymphatic systemlinotype machinelight microscopelepiota rhacodeslegal philosophylasiocampid mothlappish languagelady with the lampkepler's third lawjohn philip sousajinghpo languagejack-in-the-pulpitiron perchloridein the first placeice-hockey playerhualpai languagehordeum pusillumholy roman empirehoheria populneahimantopus stiltherpes genitalishebraic alphabethairy darling peagreen apple aphidgolden chinkapingenus sitophylusgenus sceliphrongenus salpichroagenus pollachiusgenus polianthesgenus pholistomagenus phlebodiumgenus lophosoriagenus lepechiniagenus hypsiglenagenus helipterumgenus heliophilagenus gypsophilagenus epiphyllumgenus drosophilagenus chlorophisgenus chimaphilagenus calliphoragenus calliophisgarden symphilidfriendship plantfrench polynesiaflying phalangerflavius josephusfamily ziphiidaefamily xiphiidaefamily typhaceaefamily thripidaefamily sphecidaefamily phyllidaefamily phillidaefamily phasmidaeexplosive chargeeuphorbia pepluseuphorbia litchiesophageal veinsepiscopal churchepidemic choleraenglish springerenglish primroseenglish plantaindiplomatic pouchdental handpiecedaisy print wheelcreeping thistlecreeping charliecomposite schoolclass aphasmidiachingpo languagechild psychologychannel capacitycelestial spherecaspar bartholincargo helicoptercadmium sulphideblenheim spanielblechnum spicantbleaching powderbelgian sheepdogarthropod familyarmillary sphereapostelic fatheramphibian familyalpine milk vetchafrican elephantadolph simon ochsacidophilus milk
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen