15-Letter Words Containing: E,P,H,E,I,D
(In Any Order)
There are 77 15 letter words,
50 15 letter phrases and
0 15 letter abbr's with
E,P,H,E,I,D in.
Best Scoring
Expand? | Word | Save? | Length | Usage | Points | Type | ||
---|---|---|---|---|---|---|---|---|
hypersensitized | 15 | 33 | adjectiveadj | |||||
adjective satellite • having an allergy or peculiar or excessive susceptibility (especially to a specific factor) | ||||||||
underemphasized | 15 | 33 | adjectiveadj | |||||
adjective • Insufficiently emphasized | ||||||||
underemphasizes | 15 | 32 | verbv | |||||
verb • To place insufficient emphasis on. | ||||||||
psychedelically | 15 | 31 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
diphenhydramine | 15 | 30 | nounn | |||||
noun • antihistamine (trade name Benadryl) used to treat allergic reactions involving the nasal passages (hay fever) and also to treat motion sickness | ||||||||
photosensitized | 15 | 30 | verb, adjectivev, adj | |||||
verb • make (an organism or substance) sensitive to the influence of radiant energy and especially light | ||||||||
methylphenidate | 15 | 29 | nounn | |||||
noun • central nervous system stimulant (trade name Ritalin) used in the treatment of narcolepsy in adults and attention deficit disorder in children | ||||||||
cyproheptadines | 15 | 28 | ||||||
noun • an antihistamine (trade name Periactin) used to treat some allergic reactions | ||||||||
hyperlipidemias | 15 | 28 | nounn | |||||
noun • presence of excess lipids in the blood | ||||||||
hyperventilated | 15 | 27 | verb, adjectivev, adj | |||||
verb • produce hyperventilation in • breathe excessively hard and fast | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
All 15 Letter Words
Words (77)
pseudoephedrinemethylphenidateuncomprehendingdiphenhydraminehypersensitizedacetophenetidinunderemphasizesunderemphasizedpsychedelicallypigheadednessesphotosensitizedmisapprehendinghyperstimulatedcyproheptadinesthermoperiodismradiotelephonesradiotelegraphspseudepigraphonpinheadednesseslymphadenitiseshyperventilatedhypermodernistshyperlipidemiasheadmastershipsradiotelegraphysuperencipheredvideotelephonesunderemphasisesunderemphasisedsulphacetamidesspheroidicitiessphaerosideritesesquisulphidespseudepigraphicpseudaesthesiasphotosensitisedphotoluminescedpedagoguishnessoophorectomizedoophorectomisedmiscomprehendedhypercriticizedhypercriticisedhouseholdershipgeodemographicsdisplenishmentsdiphenylketonesdiphenyleniminedexamphetaminesdermatographiesdephlogisticatedecipherabilitycinematographedchenopodiaceouscercopithecoidsapprenticehoodsweather-strippedradiotelephonicpropionaldehydeplatycephalidaepinkish-lavenderphiladelphaceaephenylacetamidephenazopyridinemyrmecophagidaehypersensitisedhyperlipoidemiahyperlipidaemiahyperadrenalismhighly-developedhearing-impairedgomphotheriidaegasterophilidaeelectrophoridaectenocephalidescercopithecidaeantheridiophorePhrases (50)
whited sepulchrewhited sepulcherspiny-headed wormpsychedelic drugpresident hooverorder chiropteraneedle spike rushgreen peach aphidgenus delphiniumdispersing phasedaphne du maurierbirthday presentbelgian shepherdadhesive plasterwindshield wiperwhitebarked pinewhite dipladeniaundirected graphstephen sondheimspotted weakfishspeak of the devilsleeping draughtreuters dispatchpsychedelic rockpresident arthurpowder techniquepicris echioidesphilippine cedarorder therapsidaorder ephemeridalepiota rhacodeskippered herringkepler's third lawjohn hoyer updikeiron perchlorideinfrared therapyhigh-protein dietgreen apple aphidgraphic designergenus pseudechisgenus phlebodiumfamily sphecidaeepidemic choleradrop in the bucketdental handpiecedaisy print wheelbleaching powderbigtoothed aspenbig-toothed aspenbelgian sheepdog