Dictionary Only:
Profanity Off:

15-Letter Words Containing: E,N,R,S,Y

 (In Any Order)
There are 222 15 letter words, 273 15 letter phrases and 0 15 letter abbr's with E,N,R,S,Y in.

Best Scoring 15 Letter Words With: E,N,R,S,Y

Expand?WordSave?LengthUsagePointsType
hydroxyprolines15
34 nounn
noun

• a crystalline amino acid obtained from gelatin or collagen

hypersensitized15
33 adjectiveadj
adjective satellite

• having an allergy or peculiar or excessive susceptibility (especially to a specific factor)

methoxyfluranes15
33
Valid word for Scrabble US
gyrofrequencies15
33 nounn
Valid word for Scrabble US
sulfinpyrazones15
32 nounn
Valid word for Scrabble US
hypersensitizes15
32 verbv
Valid word for Scrabble US
hyperexcretions15
32 nounn
Valid word for Scrabble US
neurohypophysis15
31 nounn
noun

• the posterior lobe of the pituitary body; primarily glandular in nature

symmetrizations15
31 nounn
Valid word for Scrabble US
polymerizations15
31 nounn
noun

• a chemical process that combines several monomers to form a polymer or polymeric compound

or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 15 Letter Words

Words (222)
synergisticallyoversimplifyingneurophysiologyinstrumentalitycontroversiallyrecrystallizingintrospectivelypolyunsaturateddemonstrativelyunceremoniouslyneuropsychiatryinconsideratelycorrespondinglycomprehensivelyunsymmetricallysymmetricalnessneurohypophysisinsurrectionaryhypersensitizeddemonstrabilitycentrosymmetricsuperabundantlyserendipitouslysemidocumentaryresystematizingpsychometricianproselytizationpolymerisationsoverclassifyingnonelectrolytesnitroglycerinesinteruniversityhypervigilanceshypersomnolencehypersalivationheterogeneouslyelectroanalysisdishearteninglycyproheptadinescommiseratinglyunrealisticallypolycrystallinedisinterestedlyunanswerabilitytyrannosaurusestrypanosomiasessynchronousnesssynchronicitiessymmetrizationssuperintendencysuperheterodynesuperefficiencysulfinpyrazonessubterraneouslystrongyloidosessplendiferouslysesquicentenarysemipornographysemicylindricalsemicrystallineremonstrativelyreactionaryismspsychoneuroticspseudopregnancypresynapticallyprayerfulnessespolymerizationsphenylthioureasoversensitivityobservationallyneurohypophysesmonocrystallinemethoxyfluranesmartensiticallyionosphericallyintransigeantlyintervisibilityinterpersonallyinterparoxysmalinsubordinatelyincommensurablyhypochondriaseshypnotherapistshyperventilateshypertonicitieshypersensitizeshypersecretionshypersalinitieshyperresponsivehypermodernistshyperinsulinismhyperinflationshyperextensionshyperexcretionshydroxyprolineshydrocortisoneshexylresorcinolgyrofrequencieserythropoietinselectrodynamicselectroanalysesdorsoventralitydorsiventralitydimenhydrinatescrystallinitiescryoprotectantscounterstrategycongressionallycholestyraminesbourgeoisifyingagranulocytosesaerodynamicistsunpretentiouslyunderstandinglytransferabilityprepositionallyneuropsychologyimmunochemistrydisconcertinglycrossopterygianzygobranchiatesunprogressivelyunconstrainedlytyrannousnessestyndallimetriestriphenylaminestrimethylaminestransgressivelytranscriptivelythirtysomethingsyncretizationssyncretisationssynchronoscopessynchronologiessymmetrisationssupplementarilysupernationallysuperincumbencysulphinpyrazoneseptentrionallysarcenchymatousrhombenporphyrsresystematisingresynchronizingresynchronisingresurrectionaryremythologisingremonstratinglyrecrystallisingrecognisabilitypyrotechnicianspsychoanalyzerspsychoanalysersprosenchymatousproselytisationprogressionallypresbyterianizepresbyterianiseprepossessinglyporphyrogenitespharyngoscopiesonychocryptosesoestrogenicallyneurosurgicallymonosymmetricalmodernisticallymanneristicallylaryngectomisedlabyrinthitisesirreprehensiblyintertwistinglyindiscretionaryimmensurabilityhypomenorrhoeashypocrystallinehypersensitiseshyperpolarisinghypernatraemiashyperimmunisinghydrogenisationhydrocorallineshuckleberryingsholocrystallinehemicrystallinehalfpennyworthsgerrymanderingsempyreumatisingelectrolysationdiscretionarilydehydroretinolsdehydrogenisingcyclobarbitonescybersquattingscorrespondentlyconveyorisationconsiderativelyarcheoastronomyandrogynophoresaerohydroplanesactinochemistryyellowish-orangeuninterestinglyuninstructivelythirty-somethingself-explanatoryreithrodontomyspresbyterianismpoverty-strickenpanhysterectomynorthwestwardlynortheastwardlylaryngostenosishypersensitisedhyperadrenalismhymenogastralesenergy-releasingenergy-absorbingdesynchronizingcylindricalnesscryptacanthodescryoanaesthesiaadenomyosarcoma
Phrases (273)
zea mays induratavoluntary muscletietze's syndromesummary judgmentstonecrop familyspiny-headed wormsolemnity of maryslender lady palmslender centaurysilicone polymersecurity blanketscholarly personreference systemrationalise awaypolyphonic prosepilgrim's journeyphyseter catodonpersonality testoperating systemnarragansett baymythical monstermyenteric plexusmonterey cypressmask of pregnancymagnetic pyriteslycosa tarentulainsurance policyhyoscyamus nigerhoneymoon resorthoary golden bushgenus nycticoraxgenus lycoperdongenus hyalophoragenus eriobotryagenus dasyproctageneral assemblygempylus serpenserlenmeyer flaskebony spleenwortdrive line systemdoris may lessingdiospyros ebenumdefense attorneycorylus avellanacentaurea cyanuscavity resonatorcanterbury talesbrittany spanielbirthday presentanxiety neurosisanxiety hysteriaandrei tarkovskyanchovy dressingamebic dysenteryaloys senefelderalimentary pastealexandre yersinwoolly sunflowerwomen's army corpswine-maker's yeastwestern dewberrywalt disney worldtwenty-four hoursturner's syndrometransfer paymentthrinax keyensistaymyr peninsulataimyr peninsulasystema nervosumsyringa josikaeasyrian bean capersynthetic rubbersynthetic heroinsynapsid reptilesynagrops bellussydenham's choreasunrise industrysuborder tyrannistringybark pinest. mary magdalenesprinkler systemspinal accessorysouthern cypresssixty-fourth notesir philip sidneysir edwin lutyenssiege of yorktownshooting galleryservice industrysensory receptorsensory epilepsysensory activitysedimentary rocksedimentary claysecurity councilsecondary schoolseaside centauryscrew-pine familyrydberg constantroy lichtensteinrobert tyre jonesrelative densityreiter's syndromereed canary grassrecording systemreceiving systemread-only storagequercus garryanapyloric stenosispurkinje's systempulmonary plexispsychotic personpromotion systemproboscis monkeypresident taylorprecentral gyruspond bald cypressplayground slidepinus sylvestrispeter stuyvesantpenstemon parryipasserina cyaneaparry's penstemonparis universityorderly sergeantorder zygnemalesoral personalityone-thirty-secondone hundred sixtynorthwest by westnortheast by eastnoonan's syndromenonlinear systemnews photographynew scotland yardnervus coccygeusnaked as a jaybirdmother carey's henmonostable relaymilitary sciencemeasuring systemmary harris jonesmartha's vineyardmarfan's syndromemake unnecessarylygus lineolarislouis untermeyerlady jane seymourkingfisher daisyjohn cowper powysjapanese red armyitalian ryegrassisobutyl nitritehypogastric veinhydrogen sulfidehydrogen sulfatehurler's syndromehundred years' warhorner's syndromehonorary societyhieronymus boschhenry louis aaronhearsay evidencegymnosperm genusgymnelis viridisgunnery sergeantgulf war syndromegreen mayonnaiseglyceria grandisgenus syrrhaptesgenus sisymbriumgenus rhodymeniagenus pyrophorusgenus pyracanthagenus pterocaryagenus pternohylagenus psychotriagenus porphyrulagenus polycirrusgenus polybotryagenus polybotriagenus phylloxeragenus phrynosomagenus petromyzongenus peromyscusgenus paronychiagenus oxydendrumgenus ostryopsisgenus onobrychisgenus notoryctusgenus metroxylongenus lactophrysgenus ixobrychusgenus hyphantriagenus hyperoodongenus hynerpetongenus hylocereusgenus hygrotramagenus hydrobatesgenus gymnorhinagenus gastrocybegenus dryopterisgenus drymarchongenus dacrymycesgenus cystophoragenus cynopterusgenus cyclosorusgenus crocodylusgenus corylopsisgenus coryanthesgenus chrysopsisgenus chlamyderagenus cerapteryxgenus brachycomegenus botrychiumgenus bathyergusgarment industrygarden symphilidfriendly islandsfrench polynesiafraternity housefrancisco de goyafrancis scott keyfourier analysisfield pennycressfamily sturnidaefamily sirenidaefallot's syndromeeucalypt grandiserythema nodosumernest hemingwayenglish ryegrassenglish lady crabenergy secretaryendocrine systemembryonic tissueelymus arenariusedsel bryant forddyer's mignonettedusky salamanderdrive-by shootingdowny bromegrassdestroying angeldesmodium gyransdaisy print wheelcyrus the youngercyperus rotunduscrystalline lenscottage industrycondylar processcommon snowberrycherrystone clamcharles kay ogdenbypass condenserbrown universitybroadly speakingbristly oxtonguebraun's holly fernboysenberry bushbertillon systembarnaby's thistleaversion therapyascending arteryarizona sycamoreapyretic tetanusapparel industryanxiety disorderanomalistic yearanal personalityanagyris foetidaallegheny spurgeagropyron repensaccident surgery
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen