15-Letter Words Containing: E,L,P,H,I,D
(In Any Order)
There are 63 15 letter words,
49 15 letter phrases and
0 15 letter abbr's with
E,L,P,H,I,D in.
Best Scoring 15 Letter Words With: E,L,P,H,I,D
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| hydroxylapatite | 15 | 34 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| hydroxyprolines | 15 | 34 | nounn | |||||
noun • a crystalline amino acid obtained from gelatin or collagen | ||||||||
| psychedelically | 15 | 31 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| dolichocephalic | 15 | 30 | adjectiveadj | |||||
adjective • having a relatively long head with a cephalic index of under 75 noun • an adult with a long narrow head | ||||||||
| nonhospitalized | 15 | 30 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| methylphenidate | 15 | 29 | nounn | |||||
noun • central nervous system stimulant (trade name Ritalin) used in the treatment of narcolepsy in adults and attention deficit disorder in children | ||||||||
| demographically | 15 | 29 | adverb, adjectiveadv, adj | |||||
adverb • In a demographic manner. | ||||||||
| epichlorohydrin | 15 | 29 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| dermatoglyphics | 15 | 29 | nounn | |||||
noun • the study of the whorls and loops and arches in the fingertips and on the palms of the hand and the soles of the feet | ||||||||
| polysaccharides | 15 | 28 | nounn | |||||
noun • any of a class of carbohydrates whose molecules contain chains of monosaccharide molecules | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 15 Letter Words
Words (63)
dolichocephalicmethylphenidatedemographicallysophisticatedlypsychedelicallypolysaccharidesphotoduplicatedhyperstimulatedhydroxylapatitestadtholdershipradiotelephonesradiotelegraphsphotoduplicatesnonhospitalizedlymphadenitiseshyperventilatedhyperlipidemiashydroxyprolinesepichlorohydrinchlorpropamidesamphidiploidiesradiotelegraphyideographicallydermatoglyphicsvideotelephonessulphanilamidessulphacetamidesstadholdershipssesquisulphidespteridophilistspsychodelicallypolychlorinatedphotoluminescedornithodelphousornithodelphiannonhospitalisedlipodystrophieshouseholdershipgoodfellowshipsedriophthalmousedriophthalmiandisplenishmentsdiphenylketonesdiphenyleniminediaheliotropismdesulphurationsdephlogisticatedecipherabilitydactylographiesradiotelephonicpropionaldehydeplatycephalidaepinkish-lavenderphiladelphaceaephenylacetamidehyperlipoidemiahyperlipidaemiahyperadrenalismhippoglossoideshighly-developedgasterophilidaeelectrophoridaectenocephalidesPhrases (49)
whited sepulchrewhited sepulcherpsychedelic drugneedle spike rushgraphical recordgenus delphiniumfamily lophiidaefamily aphididaebelgian shepherdadhesive plasterwindshield wiperwhite dipladeniaspruce gall aphidspeak of the devilsleeping draughtsir philip sidneypsychodelic drugpsychedelic rockpsephurus gladisphilippine cedarphase modulationorder phalangidamitella diphyllamaxfield parrishlepiota rhacodeslady with the lampkepler's third lawiron perchloridehordeum pusillumhairy darling peagreen apple aphidgolden chinkapingenus phlebodiumgenus drosophilagarden symphilidfriendship plantfamily ziphiidaefamily xiphiidaefamily thripidaefamily sphecidaefamily phyllidaefamily phillidaefamily phasmidaeepidemic choleradental handpiecedaisy print wheelcadmium sulphidebleaching powderbelgian sheepdog
