Dictionary Only:
Profanity Off:

15-Letter Words Containing: E,L,P,H,I

 (In Any Order)
There are 312 15 letter words, 182 15 letter phrases and 0 15 letter abbr's with E,L,P,H,I in.

Best Scoring

Expand?WordSave?LengthUsagePointsType
phytochemically15
35 adverb, adjectiveadv, adj
Valid word for Scrabble US
hyperpolarizing15
35 adjectiveadj
Valid word for Scrabble US
psychosexuality15
35 noun, adjectiven, adj
noun

• the mental representation of sexual activities

hydroxylapatite15
34 nounn
Valid word for Scrabble US
psychochemicals15
34 nounn
Valid word for Scrabble US
hydroxyprolines15
34 nounn
noun

• a crystalline amino acid obtained from gelatin or collagen

physicochemical15
34 adjectiveadj
adjective

• relating to physical chemistry

chlorpromazines15
33 noun, adjectiven, adj
noun

• a drug (trade name Thorazine) derived from phenothiazine that has antipsychotic effects and is used as a sedative and tranquilizer

zoogeographical15
33 adjectiveadj
Valid word for Scrabble US
xerographically15
33 adverb, adjectiveadv, adj
Valid word for Scrabble US
or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 15 Letter Words

Words (312)
electrophoresisdolichocephalicparentheticallytherapeuticallyneurophysiologyphotomultiplierplainclothesmanmethylphenidatechloramphenicoldemographicallysympatheticallyeuphemisticallyphenolphthaleincomprehensivelyimperishabilitybiogeographicalamphitheatricaluncopyrightablesophisticatedlypsychedelicallypolysaccharidesphotoduplicatedmetallographieshypervigilanceshyperstimulateshyperstimulatedhypersalivationhyperfunctionalhydroxylapatiteepitheliomatousepithelializingchlorpromazinesaccomplishmentszoogeographicalxerographicallysteeplechasingsstadtholdershipsprightlinessesrehospitalizingradiotelephonesradiotelegraphspyrotechnicallypunishabilitiespsychogenicallypsychochemicalspsychobiologiesprehistoricallypreestablishingplatyhelminthicplainclothesmenphytochemicallyphthalocyaninesphotogeologistsphotogeologicalphotoelectronicphotoduplicatesphotochemicallyphosphorylativephenylthioureasphenylketonuricphenomenologistphenomenologiesphenomenalisticpharmaceuticalspharisaicalnessperishabilitiespantheisticallypaleogeographicosteopathicallyoscillographiesophthalmologiesoceanographicalnucleophilicitynonphilosophersnonmetaphoricalnonhospitalizedneuropathologicneuropathicallymicropublishersmetamorphicallylymphadenitiseslegislatorshipsionosphericallyinterphalangealinhospitalitieshyperventilateshyperventilatedhypervelocitieshypersalinitieshyperpolarizinghypermutabilityhypermobilitieshypermetabolismhyperlipidemiashyperinvolutionhyperinsulinismhyperinflationshypercriticallyhypercatabolismhydroxyprolineshomeopathicallygeostrophicallygeomorphologistgeomorphologiesepithelizationsepiphenomenallyepichlorohydrinencephalopathicencephalitogensecophysiologiescontrollershipschlorpropamideschancellorshipsbrachycephaliesbibliotherapiesatmosphericallyamphidiploidiesallelomorphismstelegraphicallyradiotelegraphypsychosexualityphysicochemicalphotometricallyphotomechanicalphenylketonurialexicographicalideographicallyhypercatalecticelectrophoreticdermatoglyphicscomptrollershipalphabetizationlymphocytosiseszoopsychologieszoophysiologiesxenomorphicallyvideotelephonesunapprehensibletriphenylaminestrinitrophenolsthoracoplastiestheosophisticaltelautographiessymbolographiessyllabographiessulphinpyrazonesulphathiazolessulphanilamidessulphacetamidesstrephosymboliastratosphericalstereographicalstegocephaliansstadholdershipssplanchnologiessphericalnessesspeleotherapiessesquisulphidesselenographistsselenographicalseismographicalscaphocephalismscaphocephaliesrhinencephalonsrehospitalisingpulmobranchiatepterylographiespteridophilistspsychrometricalpsychogeneticalpsychodelicallypsephologicallypolysynthetismspolysyntheticalpolysynthesismspolychlorinatedpoikilothermismpoikilothermiesplagiocephaliesphyllosilicatesphrenologicallyphotoluminescesphotoluminescedphotoelasticityphlebosclerosisphilosophastersphenomenalizingphenomenalitiesphenomenalisingphantasmalitiesphallocentrismspetrochemicallyperoxysulphuricperityphlitisesperipheralitiesparaheliotropicpamphleteeringspalaeographistspalaeographicalpalaeoanthropicornithodelphousornithodelphiannonhospitalisedmicroaerophilicmicroaerophilesmetallographistmesaticephalousmesaticephaliesmegalocephaliesmacrencephaliesmacrencephaliaslophobranchiatelissencephalouslipodystrophieslieutenantshipslicentiateshipslexicographistsirreprehensiblyirreprehensibleinapprehensiblehypsometricallyhypoventilationhypocrystallinehyperpolarisinghyperphysicallyhypermetropicalhyperglycaemiashypercalcaemiashouseholdershiphistocompatibleheterographicalhepaticologistshepaticologicalheliotropicallyheliosciophytesgraphicalnessesgoodfellowshipsepithelisationsepithelialisingencephalotomieseleutherophobiceleutherophobiaelectrographiesedriophthalmousedriophthalmiandisplenishmentsdiphenylketonesdiphenyleniminediaheliotropismdesulphurationsdephlogisticatedecipherabilitydactylographiescytopathologiescounsellorshipsclimatographieschemotropicallychemolithotrophchamberlainshipcephalothoracicbrachycephalicsbrachiocephalicbiopsychologiesbalneotherapiesapheliotropismsanthropolatriesalexipharmakonsscrophularialesrhynchocephaliaradiotelephonicpropionaldehydeprechlorinationpre-raphaelitismpoikilothermousplatyhelminthesplatycephalidaepinkish-lavenderphotoheliographphotoelectricalphiladelphaceaephenylacetamidepentaerythritolparathelypterispanencephalitispaleornithologyophthalmoplegiaophioglossaceaeneuroepitheliumnephrosclerosisnephrolithiasismephistophelianmephistopheleanmarginocephalialymphocytopenialymphoblast-likehypocellularityhyperlipoidemiahyperlipidaemiahypercalcinuriahyperadrenalismhippoglossoideshighly-developedgasterophilidaeflemish-speakingenglish-speakingelectrophoridaectenocephalideschloroplatinatebrachycephalismangiohemophiliaalphabetisationalpha-interferon
Phrases (182)
whited sepulchrewhited sepulcherwhispering bellsvena ophthalmicaspanish languagerepublic of ghanapsychotic beliefpsychedelic drugpolyphonic prosepolitical spherephysical processpahlavi languagenephelium litchineedle spike rushmechanical pianolymphatic vesseljoseph priestleyjacques lipchitzimperial mammothhumphrey gilberthistorical paperheart specialistgraphical recordgenus phalangiumgenus pagophilusgenus gnaphaliumgenus geothlypisgenus delphiniumfamily lophiidaefamily aphididaecivil censorshipchemical processchechen republiccalcium sulphatebelgian shepherdadhesive plasterxerophytic plantwitch hazel plantwindshield wiperwhite dipladeniawhistle-stop tourwestern whiptailtightrope walkerteletype machinetelescopic sightsulphur bacteriastapling machinespruce gall aphidspring vetchlingsplanchnic nervesphincter musclespelling checkerspeak of the devilspanish mackerelspanish lime treeslip of the tonguesleeping draughtsir philip sidneyseriphus politussenile psychosisschizaea pusillasalvia spathaceasalmonella typhirepublic of haitirepublic of chinarepublic of chilepurple milk vetchpull in one's hornspublishing housepsychodelic drugpsychedelic rockpsephurus gladispolitical theorypliny the youngerplectognath fishphysical therapyphysical sciencephysical fitnessphylum nemertinapholis gunnellusphillis wheatleyphilippine cedarphenolic plasticphase modulationperu-chile trenchpencil sharpenerpehlevi languagepearly razorfishpeachleaf willowpathetic fallacyparticle physicsorder phalangidanemophila auritamitella diphyllamitchella repensmesophytic plantmechanical pressmechanical powermaxfield parrishmalpighian layerlymphatic tissuelymphatic systemlinotype machinelight microscopelepiota rhacodeslegal philosophylappish languagelady with the lampkepler's third lawjinghpo languagejack-in-the-pulpitiron perchloridein the first placeice-hockey playerhualpai languagehordeum pusillumholy roman empirehoheria populneaherpes genitalishebraic alphabethairy darling peagreen apple aphidgolden chinkapingenus sitophylusgenus sceliphrongenus salpichroagenus pollachiusgenus polianthesgenus pholistomagenus phlebodiumgenus lophosoriagenus lepechiniagenus hypsiglenagenus helipterumgenus heliophilagenus gypsophilagenus epiphyllumgenus drosophilagenus chlorophisgenus chimaphilagenus calliphoragenus calliophisgarden symphilidfriendship plantfrench polynesiaflying phalangerflavius josephusfamily ziphiidaefamily xiphiidaefamily typhaceaefamily thripidaefamily sphecidaefamily phyllidaefamily phillidaefamily phasmidaeexplosive chargeeuphorbia pepluseuphorbia litchiesophageal veinsepiscopal churchepidemic choleraenglish springerenglish primroseenglish plantaindental handpiecedaisy print wheelcreeping thistlecreeping charliecomposite schoolchingpo languagechannel capacitycelestial spherecargo helicoptercadmium sulphideblenheim spanielblechnum spicantbleaching powderbelgian sheepdogarmillary sphereapostelic fatheralpine milk vetchafrican elephant
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen