Dictionary Only:
Profanity Off:

15-Letter Words Containing: E,L,N,S,Y

 (In Any Order)
There are 228 15 letter words, 203 15 letter phrases and 0 15 letter abbr's with E,L,N,S,Y in.

Best Scoring 15 Letter Words With: E,L,N,S,Y

Expand?WordSave?LengthUsagePointsType
phenylbutazones15
34 nounn
noun

• anti-inflammatory drug (trade name Butazolidin)

hydroxyprolines15
34 nounn
noun

• a crystalline amino acid obtained from gelatin or collagen

methylxanthines15
33 nounn
Valid word for Scrabble US
methoxyfluranes15
33
Valid word for Scrabble US
sulfinpyrazones15
32 nounn
Valid word for Scrabble US
synecdochically15
31 adverb, adjectiveadv, adj
Valid word for Scrabble US
psychogenically15
31 adverb, adjectiveadv, adj
Valid word for Scrabble US
polymerizations15
31 nounn
noun

• a chemical process that combines several monomers to form a polymer or polymeric compound

recrystallizing15
30 verb, adjectivev, adj
verb

• To crystallize again; especially as a means of purification.

comprehensively15
30 adverbadv
adverb

• in an all-inclusive manner

or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 15 Letter Words

Words (228)
instantaneouslyanaesthesiologyconscientiouslysynergisticallyinaccessibilityoversimplifyingcondescendinglyinfinitesimallysuccinylcholineneurophysiologyinstrumentalitycontroversiallycompassionatelyrecrystallizingintrospectivelyunquestioninglypolyunsaturateddemonstrativelyunceremoniouslyinconsideratelydispassionatelycorrespondinglycomprehensivelyunsymmetricallysymmetricalnesssidesplittinglykinestheticallydemonstrabilitysuperabundantlyserendipitouslyproselytizationpolymerisationsoverclassifyingnonelectrolytesnitroglycerinesmethylxanthineshypervigilanceshypersomnolencehypersalivationheterogeneouslyenjoyablenesseselectroanalysisdishearteninglydisenchantinglycommiseratinglyankylostomiasesancylostomiasesunrealisticallypolycrystallinenonspecificallydisinterestedlyconsequentiallyunanswerabilitysynecdochicallysulfinpyrazonessubterraneouslystylelessnessesstrongyloidosessplendiferouslysemicylindricalsemicrystallineremonstrativelypsychogenicallypresynapticallyprayerfulnessespolynucleotidespolymerizationsplatinocyanidesphthalocyaninesphenylthioureasphenylbutazonespantheisticallyobservationallynucleosyntheticnucleosynthesesmonocrystallinemiscellaneouslymethoxyfluranesmartensiticallylysogenizationslymphadenitisesionosphericallyintransigeantlyintervisibilityinterpersonallyinterparoxysmalinsubordinatelyindefensibilityindefeasibilityincommensurablyimmunoassayablehyperventilateshypersalinitieshyperinsulinismhyperinflationshydroxyprolineshexylresorcinolhendecasyllablehendecasyllabicethnomusicologyelectrodynamicselectroanalysesdorsoventralitydorsiventralitycrystallinitiesconsentaneouslycongressionallycollenchymatouscholestyraminesanalyzabilitiesagranulocytosesunpretentiouslyunderstandinglytransferabilityprepositionallynucleosynthesisneuropsychologymechanisticallyinefficaciouslyindigestibilitydisconcertinglycholecystokininyieldablenessesyellowishnessesvivisectionallyunprogressivelyunconstrainedlytyndallimetriestriphenylaminestrimethylaminestransgressivelytranscriptivelyteletypesettingsynecologicallysynchronologiessupplementarilysupernationallysulphinpyrazonesignificativelyseptentrionallysemiconsciouslyremythologisingremonstratinglyrecrystallisingrecognisabilityquestionabilitypsychogeneticalpsychoanalyzerspsychoanalysersproselytisationprogressionallyprepossessinglypolyvinylidenespolysynthetismspolysyntheticalpolysynthesismspolyphloesboeanpentadactylismsoxyhaemoglobinsoestrogenicallyneurosurgicallyneologisticallymyelencephalonsmonosymmetricalmonochlamydeousmodernisticallymethylthioninesmentalisticallymanneristicallylysogenisationsleucocytopeniaslaryngectomisedlabyrinthitisesirreprehensiblyintertwistinglyinextensibilityindistinctivelyinconsecutivelyimmensurabilityhypocrystallinehyperpolarisinghydrocorallineshuckleberryingsholocrystallinehemicrystallinehalfpennyworthsglyconeogenesisglyconeogenesesexpostulatinglyepicondylitisesencyclopaedistsencyclopaedismsencomiasticallyelectrolysationdiscretionarilydiphenylketonesdemythologisingdehydroretinolsdactyliomanciescyclopentolatescyclobarbitonescyanoacetylenescorrespondentlyconsiderativelychlamydomonadesanaestheticallyaerohydroplanesyellowish-orangeyellow-blindnessunsentimentallyuninterestinglyuninstructivelyself-sufficiencyself-indulgentlyself-explanatoryself-consciouslyself-conceitedlyself-complacencyplatyhelminthesnorthwestwardlynortheastwardlymonocotyledoneslaryngostenosishyperadrenalismhymenogastralesenergy-releasingcylindricalnessactinomycetales
Phrases (203)
wassily leontiefvoluntary musclestonecrop familysolemnity of maryslender lady palmslender centaurysilicone polymersecurity blanketscholarly personrationalise awaypolyphonic prosepilgrim's journeypersonality testmythical monstermyenteric plexuslycosa tarentulajohnny appleseedinsurance policyhoary golden bushhelen wills moodygenus sylvilagusgenus lycoperdongenus lophodytesgenus hyalophoragenus geothlypisgenus eucalyptusgenus bombycillageneral assemblygempylus serpenserlenmeyer flaskebony spleenwortdrive line systemdoris may lessingdialysis machinecyclooxygenase-2cyclooxygenase-1corylus avellanacanterbury talesbrittany spanielasamiya languageanglo-saxon deityaloys senefelderalimentary pastealexandre yersinaccounts payableaccentual systemyenisei languageyellow jessaminewoolly sunflowerwayland the smithwalt disney worldtwenty-two pistoltwelve olympianstinnevelly sennatelephone systemtaymyr peninsulataimyr peninsulasystems analysissynoptic gospelssynapsid reptilesynagrops bellussylvian aqueductstephen jay gouldstanleya pinnatast. mary magdalenest valentine's daysprinkler systemspinal accessorysir philip sidneysir edwin lutyensshooting gallerysensory epilepsysenile psychosissedimentary claysecurity councilsecondary schoolscrew-pine familysayanci languagesamoyed languagesalmonella typhiroy lichtensteinrelative densityread-only storagepyloric stenosispulmonary plexispresident taylorprecentral gyruspond bald cypressplayground slidepinus sylvestrisphysical sciencephysical fitnessorderly sergeantorder zygnemalesoral personalitynova style salmonnonlinear systemnickel-base alloynew scotland yardmyxine glutinosamonostable relaymolybdenum steelmilitary sciencemesophytic plantmental synthesislygus lineolarislouis untermeyerlobbying expenselatent hostilitylady jane seymouritalian ryegrassisobutyl nitriteinelastic supplyhydrogen sulfidehydrogen sulfatehurler's syndromehenry louis aarongymnelis viridisgulf war syndromeglyceria grandisgenus tolypeutesgenus thylacinusgenus tachypleusgenus stylomecongenus sitophylusgenus pylodictusgenus pygoscelisgenus pternohylagenus porphyrulagenus polypodiumgenus polycirrusgenus polybotryagenus polybotriagenus polyangiumgenus podilymbusgenus phytolaccagenus phylloxeragenus phyllodocegenus myxinikelagenus mycoplasmagenus metroxylongenus malaclemysgenus lysimachiagenus lysichitumgenus lysichitongenus lycopodiumgenus lactophrysgenus hypsiglenagenus hylophylaxgenus hylocichlagenus hylocereusgenus heleodytesgenus gypsophilagenus gymnopilusgenus epiphyllumgenus dolichonyxgenus cyclosorusgenus crocodylusgenus corylopsisgenus chlamyderagenus calystegiagarden symphilidfriendly islandsfrench polynesiafourier analysisflux density unitfield pennycressfamily usneaceaefamily sturnidaefamily solenidaefamily sirenidaefamily scincidaefamily oniscidaefamily nyssaceaefallot's syndromeeuonymous alatuseucalypt grandisenglish ryegrassenglish lady crabelymus arenariusedsel bryant forddynamical systemdusky salamanderdiapensia familydestroying angeldental hygienistdaisy print wheelcrystalline lenscondylar processcity of the angelscherrystone clamcharles kay ogdenbush honeysucklebuilding societybroadly speakingbristly oxtonguebraun's holly fernbertillon systembarnaby's thistleapparel industryanomalistic yearanal personalityallegheny spurge
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen