15-Letter Words Containing: E,L,A,P,H,I,N,E
(In Any Order)
There are 58 15 letter words,
36 15 letter phrases and
0 15 letter abbr's with
E,L,A,P,H,I,N,E in.
Best Scoring 15 Letter Words With: E,L,A,P,H,I,N,E
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| epithelializing | 15 | 30 | verb, adjectivev, adj | |||||
Valid word for Scrabble US
| ||||||||
| methylphenidate | 15 | 29 | nounn | |||||
noun • central nervous system stimulant (trade name Ritalin) used in the treatment of narcolepsy in adults and attention deficit disorder in children | ||||||||
| hypervigilances | 15 | 29 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| epithelizations | 15 | 29 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| encephalopathic | 15 | 29 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| phenolphthalein | 15 | 28 | nounn | |||||
noun • a laxative used in many preparations under various trade names; also used as an acid-base indicator in titrations involving weak acids and strong bases because it is brilliant red at high alkalinity and colorless below pH 8 | ||||||||
| hyperventilated | 15 | 27 | verb, adjectivev, adj | |||||
verb • produce hyperventilation in • breathe excessively hard and fast | ||||||||
| epiphenomenally | 15 | 27 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| phenylketonuria | 15 | 27 | nounn | |||||
noun • a genetic disorder of metabolism; lack of the enzyme needed to turn phenylalanine into tyrosine results in an accumulation of phenylalanine in the body fluids which causes various degrees of mental deficiency | ||||||||
| phenylthioureas | 15 | 26 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 15 Letter Words
Words (58)
parentheticallymethylphenidatephenolphthaleinhypervigilancesepithelializingsteeplechasingsradiotelephonespreestablishingplainclothesmenphenylthioureasphenomenalisticlymphadenitisesinterphalangealhyperventilateshyperventilatedhypersalinitiesepithelizationsepiphenomenallyencephalopathicencephalitogensphenylketonuriaunapprehensibletriphenylaminesstegocephalianssphericalnessesselenographistsselenographicalrhinencephalonspsychogeneticalphenomenalizingphenomenalitiesphenomenalisingpamphleteeringsmacrencephaliesmacrencephaliaslissencephalouslieutenantshipslicentiateshipsinapprehensiblegraphicalnessesepithelisationsepithelialisingencephalotomiesbalneotherapiesradiotelephonicpropionaldehydeplatyhelminthespinkish-lavenderphenylacetamidepentaerythritolpanencephalitismephistophelianmephistopheleanhyperadrenalismflemish-speakingenglish-speakingctenocephalidesalpha-interferonPhrases (36)
belgian shepherdwhite dipladeniawestern whiptailteletype machinesplanchnic nervespanish mackerelspanish lime treesleeping draughtphysical sciencephylum nemertinaphilippine cedarpencil sharpenerpehlevi languagemitchella repensmechanical pressmechanical powerlinotype machinein the first placeholy roman empirehoheria populneaherpes genitalisgreen apple aphidgenus polianthesgenus lepechiniagenus hypsiglenagenus heliophilafrench polynesiaesophageal veinsdental handpiecedaisy print wheelcreeping charlieblenheim spanielbleaching powderbelgian sheepdogalpine milk vetchafrican elephant
