Dictionary Only:
Profanity Off:

15-Letter Words Containing: E,H,I,N,D

 (In Any Order)
There are 190 15 letter words, 232 15 letter phrases and 0 15 letter abbr's with E,H,I,N,D in.

Best Scoring 15 Letter Words With: E,H,I,N,D

Expand?WordSave?LengthUsagePointsType
demythologizing15
35 verb, adjectivev, adj
verb

• remove the mythical element from (writings)

overhomogenized15
34 adjectiveadj
Valid word for Scrabble US
hydroxyprolines15
34 nounn
noun

• a crystalline amino acid obtained from gelatin or collagen

azidothymidines15
34 nounn
Valid word for Scrabble US
hypersensitized15
33 adjectiveadj
adjective satellite

• having an allergy or peculiar or excessive susceptibility (especially to a specific factor)

underemphasized15
33 adjectiveadj
adjective

• Insufficiently emphasized

adenohypophysis15
32 nounn
noun

• the anterior lobe of the pituitary body; primarily glandular in nature

underemphasizes15
32 verbv
verb

• To place insufficient emphasis on.

dichlorobenzene15
32 noun, adjectiven, adj
Valid word for Scrabble US
hydromechanical15
31 adjectiveadj
Valid word for Scrabble US
or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 15 Letter Words

Words (190)
unsophisticateddisenfranchisedcounterweightedforesightednessundistinguisheddistinguishablepseudoephedrinemethylphenidatelightheadednessnearsightednessuncomprehendingdiphenhydraminetightfistednessstandoffishnesskindheartednesshypersensitizedadenohypophysisacetophenetidinuninhibitednessunderemphasizesunderemphasizedtrisoctahedronsthunderstrikingthunderstrickenpigheadednessesphotosensitizedmonosaccharidesmisapprehendinghydromechanicalfoolhardinessesechinodermatousdisheartenmentsdishearteninglydisestablishingdisenchantinglydichotomousnessdehumanizationscyproheptadineschildlikenesseschildlessnessesphotoconductivewithdrawnnessestrichomonacidessynecdochicallysledgehammeringradiotelephonespseudepigraphonpinheadednessesphotoreductionsoverwithholdingoverhomogenizednonhospitalizedlymphadenitiseshypochondriaseshyperventilatedhyperproductionhypermodernistshydroxyprolineshydrocortisoneshexosaminidaseshendecasyllabichemodynamicallyhemagglutinatedfeatherbeddingsepichlorohydrindownrightnessesdisinheritancesdisfurnishmentsdisenfranchisesdisenchantmentsdimenhydrinatesdichloroethanesdichlorobenzenedemythologizingdelightednessesdehydrogenationdehydrogenatingdechlorinationscountershadingsbenightednessesazidothymidinesweatherboardingthermodynamicallongsightednessboustrophedonicsuperencipheredvideotelephonesundernourishingunderemphasisesunderemphasisedunchristianizedunchristianisedunauthenticatedtriiodomethanesthickheadednesssulphanilamidesspheroidizationspheroidisationsherardizationssherardisationsscrimshanderingpolychlorinatedphotosensitisedphotoluminescedpedagoguishnessoverhomogenisedornithodelphousornithodelphiannudibranchiatesnonhospitalisedmultithreadingsmonophthongizedmonophthongisedmiscomprehendedlionheartednesskinetheodoliteshydrogenizationhydrogenisationhydrocorallineshoydenishnesseshoidenishnesseshereditarianistendothermicallyendocrinopathicedriophthalmiandurchkomponiertdorsibranchiatedistinguishmentdisplenishmentsdisenthralmentsdisenthrallmentdisembellishingdiphenylketonesdiphenyleniminedimethylanilinedexamphetaminesdesulphurationsdemythologisingdehypnotizationdehypnotisationdehydroretinolsdehydrogenizingdehydrogenisingdehumanisationsdechristianizesdechristianizeddechristianisesdechristianisedcinematographedchondrophorineschlorthalidoneschenopodiaceousbigheadednessesautoschediazingarchidiaconatesarachnoiditisesapprenticehoodsadiathermanciesworld-shatteringtrondheimsfjordstraight-grainedsteatornithidaeright-handednessrhinotermitidaereithrodontomysreddish-lavenderradiotelephonicradio-gramophonepropionaldehydepinkish-lavenderphenylacetamidephenazopyridinelight-mindednesskind-heartednesshypersensitisedhyperadrenalismhereditarianismhearing-impairedhamamelidoxylonhamamelidanthumdichloromethanedesynchronizingctenocephalideschicken-breastedchamaeleontidaebrownish-stripedantheridiophoreacanthoscelidesacanthisittidaeacademicianship
Phrases (232)
thomas middletonthomas de quinceyspiny-headed wormsinbad the sailorshetland islandssecond childhoodscorpaenoid fishschedule feedingrichard henry leepresident hoovernewton's third lawneedle spike rushmichael ondaatjematthew flindersmandarin chineseinherited wealthin all likelihoodhussein of jordanhundred-and-firsthorseback ridinghelen wills moodyhazard insurancegreen peach aphidgreat grandchildgenus tichodromagenus delphiniumgenus chordeilesgenus charadriusfriedrich engelsfourth dimensionfine-toothed combfine-leaved heathfamily hominidaeethanedioic aciderich mendelsohnenglish lavenderdurio zibethinusdispersing phasedialysis machinedaphne du maurierclothes designerchemical defensechange magnitudeboat-billed heronbirthday presentbernhard riemannbelgian shepherdbahasa indonesiaarthurian legendarthur eddingtonanchovy dressingaffaire d'honneurwoody nightshadewinter hardinesswindshield wiperwinchester drivewhitebarked pinewhite snapdragonwhite man's burdenwhite dipladeniawhite dead nettlewhirling dervishwestern sandwichwayland the smithvenus maidenhairvena ethmoidalisundirected graphtrain dispatchertibetan buddhismthomsen's diseasethird-degree burnthink the world oftension headacheteaching readingtarquin the proudtadzhik languageswedish languagestriped muishondstephen sondheimstannic chloridespiny-finned fishsouth sea islandssouth frigid zonesoft-shoe dancingsleeping draughtsir philip sidneysign of the zodiacshenandoah rivershanghai dialectsarda chiliensissantiago de chilesaint-john's-breadrunning headlinerhode island bentrh-negative bloodreinhold niebuhrradio brightnesspresident arthurpowder techniquephilippine cedarphase modulationpantothenic acidovulation methodorder phalangidaorder lichenalesorder branchiuraone-thirty-secondone hundred sixtyone hundred fiftynorthern woodsianorthern irelandnorth frigid zonemedicago echinusmaryland chickenmartin heideggermartha's vineyardmarlene dietrichmaidenhair berrymachine readablelowland white firkurdish languagekippered herringkingfisher daisykahoolawe islandjointed charlockjohn hoyer updikeisthmus of darieniron perchlorideinfrared therapyinfant deathrateindian chocolateindian chieftainindian chickweedhydrogen sulfidehydrogen cyanidehydrogen bromidehydraulic cementhydrangea familyhyaloid membranehundred-and-fifthhomogenized milkholbein the elderhodgkin's diseasehigher educationhigh-vitamin diethigh-protein diethidatsa languagehexanedioic acidheroin addictionheraldic bearinghenry i of englandhenri van de veldehendrik verwoerdheat dissipationhearsay evidencehearing disorderhead-in-the-cloudshamstring tendonhammer and sicklehall of residencehairy darling peagreyhound racinggreen apple aphidgraphic designergolden chinkapingenus rhodymeniagenus pseudechisgenus phlebodiumgenus hippodamiagenus drosophilagenus dolichotisgenus dolichonyxgarden symphilidfriendship plantfrench indochinaforked lightningflight attendantfashion designerfamily hydnaceaefamily hyaenidaefamily anhimidaeexhaust manifoldethanoyl radicalerythrina indicaenglish lady crabenglish foxhoundedward thorndikeedible sea urchinechinoderm genusdynamic headroomdutch east indiesduke of edinburghdrop in the bucketdrive-by shootingdoughnut machinedevonshire creamdenture adhesivedental hygienistdental handpiecedaisy print wheelcushing's diseasecrown-of-the-fieldcorona dischargecorinthian ordercommon chickweedclass echinoideachurch of irelandchlorine dioxidechlorinated limechicken sandwichchemical defencececil john rhodescatherine howardcarthusian ordercanary whitewoodcanadian hemlockbreathing devicebornholm diseasebleaching powderblack nightshadebigtoothed aspenbig-toothed aspenbenthic divisionbelgian sheepdogbehind-the-scenesbaruch de spinozaathanasian creedahmed zoki yamaniahmed zaki yamaniadmission chargeadhesive bandageacetic anhydride
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen