Dictionary Only:
Profanity Off:

15-Letter Words Containing: E,H,I,D,E

 (In Any Order)
There are 164 15 letter words, 202 15 letter phrases and 0 15 letter abbr's with E,H,I,D,E in.

Best Scoring 15 Letter Words With: E,H,I,D,E

Expand?WordSave?LengthUsagePointsType
hysterectomized15
35 verb, adjectivev, adj
verb

• To perform a hysterectomy upon.

overhomogenized15
34 adjectiveadj
Valid word for Scrabble US
demythologizers15
34 nounn
Valid word for Scrabble US
hypersensitized15
33 adjectiveadj
adjective satellite

• having an allergy or peculiar or excessive susceptibility (especially to a specific factor)

underemphasized15
33 adjectiveadj
adjective

• Insufficiently emphasized

underemphasizes15
32 verbv
verb

• To place insufficient emphasis on.

dichlorobenzene15
32 noun, adjectiven, adj
Valid word for Scrabble US
psychedelically15
31 adverb, adjectiveadv, adj
Valid word for Scrabble US
diphenhydramine15
30 nounn
noun

• antihistamine (trade name Benadryl) used to treat allergic reactions involving the nasal passages (hay fever) and also to treat motion sickness

photosensitized15
30 verb, adjectivev, adj
verb

• make (an organism or substance) sensitive to the influence of radiant energy and especially light

or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 15 Letter Words

Words (164)
disenfranchisedcounterweightedforesightednesspseudoephedrinemethylphenidatelightheadednessnearsightednessuncomprehendingdiphenhydraminetightfistednesskindheartednesshypersensitizedacetophenetidinuninhibitednessunderemphasizesunderemphasizedthyroidectomiesthunderstrickenpsychedelicallypigheadednessesphotosensitizedoverembellishedmisapprehendinghyperstimulatedfoolhardinessesechinodermatousdisheartenmentsdishearteninglycyproheptadineschildlikenesseschildlessnesseswithdrawnnessesthermoperiodismsledgehammeringradiotelephonesradiotelegraphspseudepigraphonpinheadednessesoverhomogenizedlymphadenitiseshysterectomizedhyperventilatedhypermodernistshyperlipidemiashexosaminidaseshendecasyllabichemagglutinatedheadmastershipsfeatherstitchedfeatherbeddingsdownrightnessesdisinheritancesdisenfranchisesdisenchantmentsdimenhydrinatesdichloroethanesdichlorobenzenedetachabilitiesdemythologizersdelightednessesdehydrogenationdehydrogenatingbenightednessesweatherboardingradiotelegraphylongsightednesssuperencipheredcholecystitidesvideotelephonesunderemphasisesunderemphasisedunauthenticatedtriiodomethanesthickheadednesstetartohedrismssulphacetamidesspheroidicitiessphaerosideritesesquisulphidespseudepigraphicpseudaesthesiasphotosensitisedphotoluminescedpedagoguishnessoverhomogenisedoophorectomizedoophorectomisedmiscomprehendedlionheartednesskinetheodolitesicositetrahedrahysterectomisedhypercriticizedhypercriticisedhoydenishnesseshouseholdershiphoidenishnesseshobbledehoyismsheteroscedastichereditarianisthamamelidaceousgeodemographicsendothermicallydisplenishmentsdisenthralmentsdisenthrallmentdisembellishingdiphenylketonesdiphenyleniminedimethylanilinedexamphetaminesdermatographiesdephlogisticatedemythologisersdehydroretinolsdehydrogenizingdehydrogenisingdecipherabilitydechristianizesdechristianizeddechristianisesdechristianisedcinematographedchenopodiaceouscercopithecoidsbigheadednessesapprenticehoodsadiathermanciesweather-strippedtetrasaccharidesteatornithidaeself-establishedright-handednessrhinotermitidaereddish-lavenderradiotelephonicpropionaldehydeplatycephalidaepinkish-lavenderphiladelphaceaephenylacetamidephenazopyridineover-embellishedmyrmecophagidaelight-mindednesskind-heartednesshypersensitisedhyperlipoidemiahyperlipidaemiahyperadrenalismhighly-developedhereditarianismhearing-impairedgomphotheriidaegasterophilidaeelectrophoridaediesel-hydraulicdichloromethanectenocephalideschicken-breastedchamaeleontidaecercopithecidaeantheridiophoreacanthoscelides
Phrases (202)
whited sepulchrewhited sepulcherthomas de quinceytheodore dreiserspiny-headed wormschedule feedingrichard henry leepsychedelic drugpresident hooverorder chiropteraneedle spike rushmiddle-of-the-roadmichael ondaatjematthew flindersmandarin chineseinherited wealthhookworm diseasehelen wills moodygreen peach aphidgenus delphiniumgenus chordeilesfriedrich hebbelfriedrich engelsfriedrich besselfine-toothed combfine-leaved heathethanedioic aciderich mendelsohnenglish lavenderdispersing phasedeliver the goodsdashiell hammettdaphne du maurierclothes designerchemical defensecharge d'affaireschange magnitudeboat-billed heronbirthday presentbernhard riemannbelgian shepherdarthurian legendaldehyde radicalaffaire d'honneuradhesive plasteracheta domesticawinter hardinesswindshield wiperwinchester drivewhorled milkweedwhitebarked pinewhite-tailed kitewhite-tailed deerwhite man's burdenwhite dipladeniawhite dead nettlewestern sandwichwerlhof's diseaseweighted averagevenus maidenhairvena ethmoidalisundirected graphthomsen's diseasethird-degree burntheatre directortheater directortension headacheteaching readingtay-sachs diseaseswedish rye breadswedish meatballswedish languagestephen sondheimsteel arch bridgespotted weakfishspeak of the devilsleeping draughtshenandoah riversergei diaghilevsantiago de chilerunning headlinerichard lovelacerichard e. smalleyrhode island bentrh-negative bloodreuters dispatchreinhold niebuhrpsychedelic rockpresident arthurpowder techniquepicris echioidesphilippine cedaroverhead railwayorder therapsidaorder rheiformesorder orchidalesorder lichenalesorder hyracoideaorder helotialesorder ephemeridaone-thirty-secondone hundred sixtyone hundred fiftyoliver heavisideoffice of the deadnorthern irelandmordecai richlermichael e. debakeymercury chloridemedicago echinusmartin heideggermarlene dietrichmaleic hydrazidemaidenhair berrymachine readablelepiota rhacodeslaw of archimedeskippered herringkepler's third lawjohn hoyer updikeiron perchlorideinfrared therapyinfant deathrateindian chickweedhydrogen sulfidehydrogen cyanidehydrogen bromidehydraulic cementhyaloid membranehomogenized milkholbein the elderhodgkin's diseasehigher educationhigh-protein diethexanedioic acidheraldic bearinghenry i of englandhenri van de veldehendrik verwoerdhelladic cultureheavily traveledhearsay evidencehearing disorderhead-in-the-cloudshead for the hillshammer and sicklehall of residencegreen apple aphidgraphic designergenus rhodymeniagenus pseudechisgenus phlebodiumgaucher's diseasefield hockey ballfashion designerfamily tethyidaefamily sphecidaefamily hydnaceaefamily hyaenidaefamily helicidaefamily chermidaeethmoidal arteryepidemic choleraedward thorndikeedible sea urchinechinoderm genusdutch elm diseasedutch east indiesduke of edinburghdrop in the bucketdiscovered checkdevonshire creamdenture adhesivedental hygienistdental handpiecedaisy print wheelcushing's diseasecrown-of-the-fieldcommon chickweedcoast white cedarclass echinoideaclammy chickweedcigarette holderchlorine dioxidechlorinated limechemical defencecertified chequececil john rhodescatherine howardcartridge holderbreathing devicebornholm diseaseblue-headed vireobleaching powderbigtoothed aspenbig-toothed aspenbelgian sheepdogbehind-the-scenesathanasian creedarmoured vehicleadhesive bandageacetic anhydride
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen