15-Letter Words Containing: D,H,I,L,P
(In Any Order)
There are 74 15 letter words,
64 15 letter phrases and
0 15 letter abbr's with
D,H,I,L,P in.
Best Scoring
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| hydroxylapatite | 15 | 34 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| hydroxyprolines | 15 | 34 | nounn | |||||
noun • a crystalline amino acid obtained from gelatin or collagen | ||||||||
| hypochondriacal | 15 | 31 | adjectiveadj | |||||
adjective satellite • suffering from hypochondria | ||||||||
| psychedelically | 15 | 31 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| dolichocephalic | 15 | 30 | adjectiveadj | |||||
adjective • having a relatively long head with a cephalic index of under 75 noun • an adult with a long narrow head | ||||||||
| nonhospitalized | 15 | 30 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| methylphenidate | 15 | 29 | nounn | |||||
noun • central nervous system stimulant (trade name Ritalin) used in the treatment of narcolepsy in adults and attention deficit disorder in children | ||||||||
| demographically | 15 | 29 | adverb, adjectiveadv, adj | |||||
adverb • In a demographic manner. | ||||||||
| epichlorohydrin | 15 | 29 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| dermatoglyphics | 15 | 29 | nounn | |||||
noun • the study of the whorls and loops and arches in the fingertips and on the palms of the hand and the soles of the feet | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 15 Letter Words
Words (74)
dolichocephalicpulchritudinousmethylphenidatehypochondriacaldemographicallysophisticatedlypsychedelicallypolysaccharidesphotoduplicatedhyperstimulatedhydroxylapatitestadtholdershipradiotelephonesradiotelegraphsphotoduplicatesphilanthropoidsnonhospitalizedlymphadenitiseshyperventilatedhyperlipidemiashydroxyprolinesepichlorohydrindiastrophicallychlorpropamidesamphidiploidiesachondroplasiasradiotelegraphyideographicallydermatoglyphicsachondroplasticvideotelephonessulphanilamidessulphacetamidesstadholdershipssesquisulphidesradiophonicallypteridophilistspsychodelicallypolychlorinatedphotoluminescedornithodelphousornithodelphiannonhospitalisedlipodystrophiesidiomorphicallyhydrotropicallyhydropathicallyhouseholdershipgoodfellowshipsedriophthalmousedriophthalmiandisplenishmentsdiphenylketonesdiphenyleniminediaheliotropismdesulphurationsdephlogisticatedecipherabilitydactylographiescardiographicalradiotelephonicpropionaldehydeplatycephalidaepinkish-lavenderphiladelphaceaephenylacetamidehyperlipoidemiahyperlipidaemiahyperadrenalismhippoglossoideshighly-developedgasterophilidaeelectrophoridaectenocephalidesPhrases (64)
whited sepulchrewhited sepulcherpsychedelic drugneedle spike rushlight adaptationlanding approachhonduran capitalgraphical recordgenus delphiniumfamily lophiidaefamily aphididaebelgian shepherdadhesive plasterwindshield wiperwhite dipladeniatyphoid bacillussulphanilic acidspruce gall aphidspeak of the devilsleeping draughtsir philip sidneyralph richardsonpsychodelic drugpsychedelic rockpsephurus gladisphylum phoronidapholiota flavidaphilippine cedarphase modulationorder phalangidamitella diphyllamaxfield parrishlepiota rhacodeslasiocampid mothlady with the lampkepler's third lawiron perchloridehordeum pusillumhairy darling peagreen apple aphidgolden chinkapingenus phlebodiumgenus drosophilagarden symphilidfriendship plantfamily ziphiidaefamily xiphiidaefamily thripidaefamily sphecidaefamily phyllidaefamily phillidaefamily phasmidaeepidemic choleradiplomatic pouchdental handpiecedaisy print wheelclass aphasmidiachild psychologycadmium sulphidebleaching powderbelgian sheepdogarthropod familyadolph simon ochsacidophilus milk
