Dictionary Only:
Profanity Off:

15-Letter Words Containing: D,H,I,L

 (In Any Order)
There are 160 15 letter words, 248 15 letter phrases and 0 15 letter abbr's with D,H,I,L in.

Best Scoring 15 Letter Words With: D,H,I,L

Expand?WordSave?LengthUsagePointsType
demythologizing15
35 verb, adjectivev, adj
verb

• remove the mythical element from (writings)

hydroxylapatite15
34 nounn
Valid word for Scrabble US
hydroxyprolines15
34 nounn
noun

• a crystalline amino acid obtained from gelatin or collagen

demythologizers15
34 nounn
Valid word for Scrabble US
chlorothiazides15
33 noun, adjectiven, adj
noun

• a diuretic drug (trade name Diuril) used in the treatment of edema and hypertension

dichlorobenzene15
32 noun, adjectiven, adj
Valid word for Scrabble US
hypochondriacal15
31 adjectiveadj
adjective satellite

• suffering from hypochondria

psychedelically15
31 adverb, adjectiveadv, adj
Valid word for Scrabble US
hydromechanical15
31 adjectiveadj
Valid word for Scrabble US
synecdochically15
31 adverb, adjectiveadv, adj
Valid word for Scrabble US
or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 15 Letter Words

Words (160)
dolichocephalicdistinguishablepulchritudinousmethylphenidatelightheadednesshypochondriacaldemographicallysophisticatedlypsychedelicallypolysaccharidesphotoduplicatedoverembellishedhyperstimulatedhydroxylapatitehydromechanicalhydrobiologicalfoolhardinessesdistinguishablydishearteninglydisestablishingdisenchantinglychildlikenesseschildlessnessesbronchodilatorstrichomonacidalsynecdochicallystadtholdershipsledgehammeringradiotelephonesradiotelegraphsradiochemicallyphotoduplicatesphilanthropoidsoverwithholdingorthodonticallynonhospitalizedlymphadenitiseslabyrinthodontshyperventilatedhyperlipidemiashydroxyprolineshydrostaticallyhydrobiologistshendecasyllabichemodynamicallyhemagglutinatedgeohydrologistsepichlorohydrindithyrambicallydichloroethanesdichlorobenzenediastrophicallydetachabilitiesdemythologizingdemythologizersdelightednessesdechlorinationschlorpropamideschlorothiazidesamphidiploidiesachondroplasiasthermodynamicalradiotelegraphyoligosaccharidelongsightednessideographicallydermatoglyphicsachondroplasticcholecystitidesvideotelephonessynarthrodiallysulphanilamidessulphacetamidesstadholdershipssesquisulphidesscratchbuildingscratchbuildersradiophonicallypteridophilistspsychodelicallypolychlorinatedphotoluminescedornithodelphousornithodelphiannonhospitalisedmultithreadingslipodystrophieslionheartednesskinetheodolitesidiomorphicallyichthyodoryliteichthyodorulitehydrotropicallyhydropathicallyhydrometricallyhydrogeologistshydrogeologicalhydrocorallineshouseholdershiphobbledehoyismshamamelidaceousgoodfellowshipsflashforwardingendothermicallyedriophthalmousedriophthalmiandolichosaurusesdisplenishmentsdisharmoniouslydishabilitationdishabilitatingdisenthralmentsdisenthrallmentdisembellishingdiphenylketonesdiphenyleniminedimethylanilinediaheliotropismdesulphurationsdephlogisticatedemythologisingdemythologisersdehydroretinolsdecipherabilitydactylographieschlorthalidonescardiographicalbrachydiagonalsbrachydactylismbrachydactyliesbloodthirstiestworld-shatteringself-establishedreddish-lavenderradiotelephonicpropionaldehydeplatycephalidaepinkish-lavenderphiladelphaceaephenylacetamideover-embellishedlight-mindednesslabyrinthodontahyperlipoidemiahyperlipidaemiahyperadrenalismhippoglossoideshighly-developedhamamelidoxylonhamamelidanthumgasterophilidaeelectrophoridaediesel-hydraulicdichloromethanectenocephalideschrysochloridaechamaeleontidaechabad-lubavitchbrightly-coloredacanthoscelides
Phrases (248)
wild bill hickockwhited sepulchrewhited sepulcherugandan shillingthomas middletonsinbad the sailorshetland islandssecond childhoodschedule feedingsandwich islandsrichard henry leepsychedelic drugoliver goldsmithnewton's third lawneedle spike rushnational holidaymiddle-of-the-roadmichael ondaatjematthew flindersmandibular notchlight adaptationlanding approachitalian sandwichinherited wealthin all likelihoodhonduran capitalhelen wills moodygreat grandchildgraphical recordgenus delphiniumgenus chordeilesfriedrich hebbelfriedrich engelsfriedrich besselfine-leaved heathfamily lophiidaefamily hominidaefamily aphididaeerich mendelsohnenglish lavenderemma hart willarddihydric alcoholdialysis machinedeliver the goodsdashiell hammettclothes designerchemical defensebutterfly orchidboat-billed heronbelgian shepherdbathyal districtbartholomeu diazbartholomeu diasarthurian legendalfred hitchcockaldehyde radicaladhesive plasterwindshield wiperwhorled milkweedwhite-tailed kitewhite-tailed deerwhite dipladeniawhite dead nettlewhirling dervishwerlhof's diseasewayland the smithvena ethmoidalisulmus hollandicatyphoid bacillustorchwood familythink the world oftadzhik languageswedish meatballswedish languagesulphanilic acidsteel arch bridgestannic chloridespruce gall aphidspeak of the devilsouth sea islandssleeping draughtsir philip sidneysida rhombifoliashanghai dialectsergei diaghilevsarda chiliensissantiago de chilesagebrush lizardrunning headlinerichard lovelacerichard e. smalleyrhus diversilobarhode island bentrh-negative bloodreinhold niebuhrralph richardsonpsychodelic drugpsychedelic rockpsephurus gladisphylum phoronidapholiota flavidaphilippine cedarphase modulationovulation methodoverhead railwayorder phalangidaorder orchidalesorder lichenalesorder helotialesoliver heavisideold church slavicnorthern irelandmuhammad al-mahdimordecai richlermitella diphyllamichaelmas daisymichael e. debakeymethacrylic acidmercury chloridemaxfield parrishmaryland chickenmarshalling yardmarshall islandsmarlene dietrichmanhattan islandmaleic hydrazidemaktab al-khidmatmachine readablelowland white firlouis harold graylightly armouredlepiota rhacodeslazy daisy stitchlaying on of handslaw of archimedeslasiocampid mothlady with the lampladder-back chairkurdish languagekepler's third lawkahoolawe islandjointed charlockiron perchlorideindian chocolateian douglas smithhydroxyl radicalhydrogen sulfidehydraulic systemhydraulic cementhydraulic brakeshydrangea familyhyaloid membranehuldrych zwinglihordeum pusillumhomogenized milkholbein the elderhidatsa languageheraldic bearinghenry i of englandhenri van de veldehelladic cultureheavily traveledhead-in-the-cloudshead for the hillshawaiian islandsharold godwinsonhammer and sicklehall of residencehaldea striatulahairy darling peaguiana highlandsgreen apple aphidgracilariid mothgolden chinkapingenus phlebodiumgenus drosophilagenus dolichotisgenus dolichonyxgarden symphilidfriendship plantforked lightningflight indicatorflight attendantflathead catfishfield hockey ballfamily ziphiidaefamily xiphiidaefamily thripidaefamily tethyidaefamily sphecidaefamily phyllidaefamily phillidaefamily phasmidaefamily hydnaceaefamily hyaenidaefamily homaridaefamily helicidaefamily cichlidaefamily chermidaefamily chalcidaefamily bruchidaefamily anhimidaeexhaust manifoldethmoidal arteryethanoyl radicalepidemic choleraenglish lady crabenglish foxhoundedible sea urchindutch elm diseasedog's-tooth violetdisability checkdiplomatic pouchdental hygienistdental handpiecedaylight savingsdaisy print wheelcrown-of-the-fieldclass echinoideaclass aphasmidiaclammy chickweedcigarette holderchurch of irelandchuck-will's-widowchoroidal arterychlorine dioxidechlorinated limechild psychologychemical defencececil john rhodescartridge holdercanadian hemlockcalcium chloridecadmium sulphidebullhead catfishbornholm diseaseblue-headed vireobleaching powderblack rudderfishblack nightshadebelgian sheepdogbartholin's glandarthropod familyarmoured vehiclearchibald wavellanimal husbandryadolph simon ochsacidophilus milk
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen