Dictionary Only:
Profanity Off:

15-Letter Words Containing: D,H,E,N

 (In Any Order)
There are 243 15 letter words, 313 15 letter phrases and 0 15 letter abbr's with D,H,E,N in.

Best Scoring 15 Letter Words With: D,H,E,N

Expand?WordSave?LengthUsagePointsType
demythologizing15
35 verb, adjectivev, adj
verb

• remove the mythical element from (writings)

lymphadenopathy15
34 nounn
noun

• chronic abnormal enlargement of the lymph nodes (usually associated with disease)

overhomogenized15
34 adjectiveadj
Valid word for Scrabble US
hydroxyprolines15
34 nounn
noun

• a crystalline amino acid obtained from gelatin or collagen

azidothymidines15
34 nounn
Valid word for Scrabble US
hypersensitized15
33 adjectiveadj
adjective satellite

• having an allergy or peculiar or excessive susceptibility (especially to a specific factor)

underemphasized15
33 adjectiveadj
adjective

• Insufficiently emphasized

haphazardnesses15
33
noun

• the quality of lacking any predictable order or plan

adenohypophysis15
32 nounn
noun

• the anterior lobe of the pituitary body; primarily glandular in nature

underemphasizes15
32 verbv
verb

• To place insufficient emphasis on.

or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 15 Letter Words

Words (243)
unsophisticateddisenfranchisedlymphadenopathycounterweightedforesightednessundistinguisheddistinguishablepseudoephedrinemethylphenidatelightheadednessnearsightednessunderhandednessuncomprehendingdiphenhydraminewarmheartednesstightfistednessstandoffishnesssoftheartednesskindheartednesshypersensitizeddownheartednesscoldheartednessadenohypophysisacetophenetidinuninhibitednessunderemphasizesunderemphasizedunchoreographedtrueheartednesstrisoctahedronsthunderstrikingthunderstrickentenderheartedlyswellheadednesspigheadednessesphotosensitizedopenmouthednessopenheartednessmonosaccharidesmisapprehendinghydromechanicalfoolhardinessesechinodermatousdisheartenmentsdishearteninglydisestablishingdisenchantinglydichotomousnessdehumanizationsdeathlessnessescyproheptadineschildlikenesseschildlessnessesphotoconductivelevelheadednesswrongheadednesswithdrawnnessestrichomonacidestetrahydrofuransynecdochicallysuperheterodynesledgehammeringroundheadednessradiotelephonespseudepigraphonpinheadednessesphotoreductionsoverwithholdingoverhomogenizedoffhandednessesnonhospitalizedlymphadenitiseshypochondriaseshyperventilatedhyperproductionhypermodernistshydroxyprolineshydrocortisoneshotheadednesseshexosaminidaseshendecasyllablehendecasyllabichemodynamicallyhemagglutinatedhazardousnesseshaphazardnessesgrandparenthoodfeatherbeddingsfatheadednessesepichlorohydrineggheadednessesdownrightnessesdisinheritancesdisfurnishmentsdisenfranchisesdisenchantmentsdimenhydrinatesdichloroethanesdichlorobenzenedemythologizingdelightednessesdehydrogenationdehydrogenatingdechlorinationscountershadingsclearheadednessbenightednessesazidothymidinesadenohypophysesweatherboardingthermodynamicallongsightednesshalfheartednessboustrophedonicsuperencipheredvideotelephonesundernourishingunderemphasisesunderemphasisedunchristianizedunchristianisedunauthenticatedunashamednessestriiodomethanesthreefoldnessesthickheadednesssulphanilamidesspheroidizationspheroidisationsherardizationssherardisationsscrimshanderingpolychlorinatedphotosensitisedphotoluminescedpedagoguishnessoverhomogenisedornithodelphousornithodelphiannudibranchiatesnonhospitalisednebuchadnezzarsmultithreadingsmonophthongizedmonophthongisedmonochlamydeousmiscomprehendedlymphoadenomatalionheartednesskinetheodoliteshydrogenizationhydrogenisationhydrocorallineshoydenishnesseshoidenishnesseshereditarianistergatandromorphendothermicallyendocrinopathicenchondromatousedriophthalmiandurchkomponiertdorsibranchiatedistinguishmentdisplenishmentsdisenthralmentsdisenthrallmentdisembellishingdiphenylketonesdiphenyleniminedimethylanilinedexamphetaminesdesulphurationsdemythologisingdehypnotizationdehypnotisationdehydroretinolsdehydrogenizingdehydrogenisingdehumanisationsdechristianizesdechristianizeddechristianisesdechristianiseddebauchednessescinematographedchondroskeletonchondrophorineschlorthalidoneschlamydomonadeschenopodiaceousbrokenheartedlyblockheadednessbigheadednessesautoschediazingarchidiaconatesarachnoiditisesapprenticehoodsandrogynophoresaerohydroplanesadiathermanciesworld-shatteringtrondheimsfjordstraight-grainedsteatornithidaeround-shoulderedright-handednessrhinotermitidaereithrodontomysreddish-lavenderradiotelephonicradio-gramophonepropionaldehydepinkish-lavenderphenylacetamidephenazopyridinenorthwestwardlynortheastwardlynorethandrolonelight-mindednesskind-heartednesshypersensitisedhyperadrenalismhereditarianismheavy-handednesshearing-impairedhardheartednesshamamelidoxylonhamamelidanthumgood-humorednessentandrophragmadichloromethanedesynchronizingctenocephalidescryptacanthodeschicken-breastedchestnut-coloredchamaeleontidaebrownish-stripedantheridiophoreacanthoscelidesacanthisittidaeacademicianship
Phrases (313)
wystan hugh audenthomas middletonthomas de quinceyspiny-headed wormsinbad the sailorshetland islandssecond childhoodscorpaenoid fishschedule feedingsawed-off shotgunrichard henry leepresident hooverphyseter catodonnewton's third lawneedle spike rushmichael ondaatjematthew flindersmandarin chineselangue d'oc frenchjonathan edwardsjohnny appleseedinherited wealthin all likelihoodhussein of jordanhundred-and-firsthorseback ridinghorned chameleonhoary golden bushhenry van de veldehelen wills moodyhazard insurancegreen peach aphidgreat grandchildgenus tichodromagenus lophodytesgenus delphiniumgenus chordeilesgenus charadriusgenus asphodelusfriedrich engelsfourth dimensionfine-toothed combfine-leaved heathfamily hominidaeethanedioic aciderich mendelsohnenglish lavenderdurio zibethinusdispersing phasedialysis machinedaphne du maurierclothes designerchemical defensechange magnitudeboat-billed heronbirthday presentbernhard riemannbelgian shepherdbahasa indonesiaarthurian legendarthur eddingtonanchovy dressinganchorage groundaffaire d'honneurwoody nightshadewinter hardinesswindshield wiperwinchester drivewhitebarked pinewhite snapdragonwhite man's burdenwhite dipladeniawhite dead nettlewhirling dervishwestern sandwichwayland the smithvenus maidenhairvena ethmoidalisundirected graphunder-the-counterunder the weathertrain dispatchertibetan buddhismthomsen's diseasethird-degree burnthink the world oftension headacheteaching readingtarquin the proudtadzhik languagesydenham's choreaswedish languagestriped muishondstephen sondheimstephen jay gouldstephen a. douglasstannic chloridespiny-finned fishsouth sea islandssouth frigid zonesoft-shoe dancingslough of despondsleeping draughtsir philip sidneysign of the zodiacshenandoah rivershanghai dialectsecondary schoolsecond-hand storesarda chiliensissantiago de chilesaint-john's-breadrunning headlineround-headed leekrhus rhodanthemarhode island bentrh-negative bloodreinhold niebuhrredundancy checkraymond chandlerradio brightnesspush-down storagepresident arthurpowder techniquepolyhedral anglephilippine cedarphase modulationpantothenic acidovulation methodorder sphagnalesorder phalangidaorder lichenalesorder branchiuraone-thirty-secondone hundred sixtyone hundred fortyone hundred fiftynymphaea odoratanorthern woodsianorthern irelandnorth frigid zonenoah and the floodnew zealand beechnarrowhead morelmujahedeen khalqmedicago echinusmaryland chickenmartin heideggermartha's vineyardmarlene dietrichmaidenhair berrymad anthony waynemachine readablelowland white firkurdish languagekippered herringkingfisher daisykahoolawe islandjointed charlockjohn hoyer updikejohn edgar hooverjohn donald budgeisthmus of darieniron perchlorideinfrared therapyinfant deathrateindian chocolateindian chieftainindian chickweedhydrogen sulfidehydrogen sulfatehydrogen cyanidehydrogen bromidehydraulic cementhydrangea familyhyaloid membranehurler's syndromehundred-and-tenthhundred-and-fifthhundred years' warhundred thousandhumboldt currenthottentot's breadhorner's syndromehooded merganserhomogenized milkholbein the elderhodgkin's diseasehigher educationhigh-vitamin diethigh-protein diethidatsa languagehexanedioic acidheroin addictionheraldic bearinghenry v of englandhenry i of englandhenri van de veldehendrik verwoerdheat dissipationhearsay evidencehearing disorderhead-in-the-cloudsharold hart cranehamstring tendonhammer and sicklehalle-an-der-saalehall of residencehairy darling peagreyhound racinggreen apple aphidgraphic designergolden parachutegolden handshakegolden chinkapinget off the groundgenus rhodymeniagenus pseudechisgenus phyllodocegenus phlebodiumgenus hyperoodongenus hydrobatesgenus hippodamiagenus heleodytesgenus haemodorumgenus drymarchongenus drosophilagenus dolichotisgenus dolichonyxgenus desmanthusgenus chlamyderagenus achoerodusgarden symphilidfriendship plantfrench indochinaforked lightningfly off the handleflight attendantfashion designerfamily hydnaceaefamily hyaenidaefamily anhimidaefalse dragonheadfalse dragon headexhaust manifoldevery now and thenethanoyl radicalerythrina indicaerythema nodosumenglish lady crabenglish foxhoundedward thorndikeedible sea urchinechinoderm genuseastern orthodoxdynamic headroomdutch east indiesduke of edinburghdrop in the bucketdrive-by shootingdoughnut machinedonald barthelmedevonshire creamdenture adhesivedental hygienistdental handpiecedaisy print wheelcushing's diseasecrown-of-the-fieldcorona dischargecorinthian ordercommonwealth daycommon horehoundcommon chickweedcommon arrowheadcommand overheadclass echinoideachurch of irelandchurch of englandchocolate fonduechlorine dioxidechlorinated limechicken sandwichchemical defencechelate compoundcharles kay ogdenchardonnay grapececil john rhodescatherine howardcarthusian ordercanary whitewoodcanadian hemlockbreathing devicebornholm diseasebleaching powderblack nightshadebigtoothed aspenbig-toothed aspenbenthic divisionbelgian sheepdogbel and the dragonbehind-the-scenesbaruch de spinozabald-faced hornetattendance checkathanasian creedarnold schonbergalfred hawthorneahmed zoki yamaniahmed zaki yamaniadmission chargeadhesive bandageacetic anhydride
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen