15-Letter Words Containing: D,E,L,P,H,I,N
(In Any Order)
There are 25 15 letter words,
22 15 letter phrases and
0 15 letter abbr's with
D,E,L,P,H,I,N in.
Best Scoring 15 Letter Words With: D,E,L,P,H,I,N
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| hydroxyprolines | 15 | 34 | nounn | |||||
noun • a crystalline amino acid obtained from gelatin or collagen | ||||||||
| nonhospitalized | 15 | 30 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| methylphenidate | 15 | 29 | nounn | |||||
noun • central nervous system stimulant (trade name Ritalin) used in the treatment of narcolepsy in adults and attention deficit disorder in children | ||||||||
| epichlorohydrin | 15 | 29 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| hyperventilated | 15 | 27 | verb, adjectivev, adj | |||||
verb • produce hyperventilation in • breathe excessively hard and fast | ||||||||
| lymphadenitises | 15 | 26 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| radiotelephones | 15 | 21 | noun, adjectiven, adj | |||||
noun • telephony that uses transmission by radio rather than by wire • a telephone that communicates by radio waves rather than along cables | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 15 Letter Words
Words (25)
methylphenidateradiotelephonesnonhospitalizedlymphadenitiseshyperventilatedhydroxyprolinesepichlorohydrinvideotelephonessulphanilamidespolychlorinatedphotoluminescedornithodelphousornithodelphiannonhospitalisededriophthalmiandisplenishmentsdiphenylketonesdiphenyleniminedesulphurationsradiotelephonicpropionaldehydepinkish-lavenderphenylacetamidehyperadrenalismctenocephalidesPhrases (22)
needle spike rushgenus delphiniumbelgian shepherdwindshield wiperwhite dipladeniasleeping draughtsir philip sidneyphilippine cedarphase modulationorder phalangidairon perchloridehairy darling peagreen apple aphidgolden chinkapingenus phlebodiumgenus drosophilagarden symphilidfriendship plantdental handpiecedaisy print wheelbleaching powderbelgian sheepdog
