15-Letter Words Containing: D,E,H,I,L,P,S
(In Any Order)
There are 40 15 letter words,
29 15 letter phrases and
0 15 letter abbr's with
D,E,H,I,L,P,S in.
Best Scoring 15 Letter Words With: D,E,H,I,L,P,S
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| hydroxyprolines | 15 | 34 | nounn | |||||
noun • a crystalline amino acid obtained from gelatin or collagen | ||||||||
| psychedelically | 15 | 31 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| nonhospitalized | 15 | 30 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| dermatoglyphics | 15 | 29 | nounn | |||||
noun • the study of the whorls and loops and arches in the fingertips and on the palms of the hand and the soles of the feet | ||||||||
| polysaccharides | 15 | 28 | nounn | |||||
noun • any of a class of carbohydrates whose molecules contain chains of monosaccharide molecules | ||||||||
| hyperlipidemias | 15 | 28 | nounn | |||||
noun • presence of excess lipids in the blood | ||||||||
| chlorpropamides | 15 | 27 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| sophisticatedly | 15 | 26 | adverbadv | |||||
Valid word for Scrabble US
| ||||||||
| hyperstimulated | 15 | 26 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| lymphadenitises | 15 | 26 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 15 Letter Words
Words (40)
sophisticatedlypsychedelicallypolysaccharideshyperstimulatedstadtholdershipradiotelephonesradiotelegraphsphotoduplicatesnonhospitalizedlymphadenitiseshyperlipidemiashydroxyprolineschlorpropamidesamphidiploidiesdermatoglyphicsvideotelephonessulphanilamidessulphacetamidesstadholdershipssesquisulphidespteridophilistspsychodelicallyphotoluminescedornithodelphousnonhospitalisedlipodystrophieshouseholdershipgoodfellowshipsedriophthalmousdisplenishmentsdiphenylketonesdiaheliotropismdesulphurationsdephlogisticatedactylographiespinkish-lavenderhyperadrenalismhippoglossoidesgasterophilidaectenocephalidesPhrases (29)
whited sepulchrewhited sepulcherpsychedelic drugneedle spike rushgenus delphiniumbelgian shepherdadhesive plasterwindshield wiperspruce gall aphidspeak of the devilsleeping draughtsir philip sidneypsychodelic drugpsychedelic rockpsephurus gladisphase modulationmaxfield parrishlepiota rhacodeskepler's third lawhordeum pusillumgenus phlebodiumgenus drosophilagarden symphilidfriendship plantfamily sphecidaefamily phasmidaedaisy print wheelcadmium sulphidebelgian sheepdog
