Dictionary Only:
Profanity Off:

15-Letter Words Containing: D,E,H,I,L

 (In Any Order)
There are 130 15 letter words, 201 15 letter phrases and 0 15 letter abbr's with D,E,H,I,L in.

Best Scoring 15 Letter Words With: D,E,H,I,L

Expand?WordSave?LengthUsagePointsType
demythologizing15
35 verb, adjectivev, adj
verb

• remove the mythical element from (writings)

hydroxylapatite15
34 nounn
Valid word for Scrabble US
hydroxyprolines15
34 nounn
noun

• a crystalline amino acid obtained from gelatin or collagen

demythologizers15
34 nounn
Valid word for Scrabble US
chlorothiazides15
33 noun, adjectiven, adj
noun

• a diuretic drug (trade name Diuril) used in the treatment of edema and hypertension

dichlorobenzene15
32 noun, adjectiven, adj
Valid word for Scrabble US
psychedelically15
31 adverb, adjectiveadv, adj
Valid word for Scrabble US
hydromechanical15
31 adjectiveadj
Valid word for Scrabble US
synecdochically15
31 adverb, adjectiveadv, adj
Valid word for Scrabble US
hemodynamically15
31 adverb, adjectiveadv, adj
Valid word for Scrabble US
or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 15 Letter Words

Words (130)
dolichocephalicdistinguishablemethylphenidatelightheadednessdemographicallysophisticatedlypsychedelicallypolysaccharidesphotoduplicatedoverembellishedhyperstimulatedhydroxylapatitehydromechanicalfoolhardinessesdishearteninglydisestablishingdisenchantinglychildlikenesseschildlessnessessynecdochicallystadtholdershipsledgehammeringradiotelephonesradiotelegraphsradiochemicallyphotoduplicatesoverwithholdingnonhospitalizedlymphadenitiseshyperventilatedhyperlipidemiashydroxyprolineshendecasyllabichemodynamicallyhemagglutinatedgeohydrologistsepichlorohydrindichloroethanesdichlorobenzenedetachabilitiesdemythologizingdemythologizersdelightednessesdechlorinationschlorpropamideschlorothiazidesamphidiploidiesthermodynamicalradiotelegraphyoligosaccharidelongsightednessideographicallydermatoglyphicscholecystitidesvideotelephonessulphanilamidessulphacetamidesstadholdershipssesquisulphidesscratchbuilderspteridophilistspsychodelicallypolychlorinatedphotoluminescedornithodelphousornithodelphiannonhospitalisedmultithreadingslipodystrophieslionheartednesskinetheodolitesichthyodoryliteichthyodorulitehydrometricallyhydrogeologistshydrogeologicalhydrocorallineshouseholdershiphobbledehoyismshamamelidaceousgoodfellowshipsendothermicallyedriophthalmousedriophthalmiandolichosaurusesdisplenishmentsdisenthralmentsdisenthrallmentdisembellishingdiphenylketonesdiphenyleniminedimethylanilinediaheliotropismdesulphurationsdephlogisticatedemythologisingdemythologisersdehydroretinolsdecipherabilitydactylographieschlorthalidonesbrachydactyliesbloodthirstiestworld-shatteringself-establishedreddish-lavenderradiotelephonicpropionaldehydeplatycephalidaepinkish-lavenderphiladelphaceaephenylacetamideover-embellishedlight-mindednesshyperlipoidemiahyperlipidaemiahyperadrenalismhippoglossoideshighly-developedhamamelidoxylonhamamelidanthumgasterophilidaeelectrophoridaediesel-hydraulicdichloromethanectenocephalideschrysochloridaechamaeleontidaebrightly-coloredacanthoscelides
Phrases (201)
whited sepulchrewhited sepulcherthomas middletonsinbad the sailorshetland islandssecond childhoodschedule feedingrichard henry leepsychedelic drugoliver goldsmithnewton's third lawneedle spike rushmiddle-of-the-roadmichael ondaatjematthew flindersinherited wealthin all likelihoodhelen wills moodygreat grandchildgraphical recordgenus delphiniumgenus chordeilesfriedrich hebbelfriedrich engelsfriedrich besselfine-leaved heathfamily lophiidaefamily hominidaefamily aphididaeerich mendelsohnenglish lavenderemma hart willarddialysis machinedeliver the goodsdashiell hammettclothes designerchemical defensebutterfly orchidboat-billed heronbelgian shepherdbartholomeu diazbartholomeu diasarthurian legendalfred hitchcockaldehyde radicaladhesive plasterwindshield wiperwhorled milkweedwhite-tailed kitewhite-tailed deerwhite dipladeniawhite dead nettlewhirling dervishwerlhof's diseasewayland the smithvena ethmoidalisthink the world oftadzhik languageswedish meatballswedish languagesteel arch bridgestannic chloridespruce gall aphidspeak of the devilsouth sea islandssleeping draughtsir philip sidneyshanghai dialectsergei diaghilevsarda chiliensissantiago de chilesagebrush lizardrunning headlinerichard lovelacerichard e. smalleyrhus diversilobarhode island bentrh-negative bloodreinhold niebuhrpsychodelic drugpsychedelic rockpsephurus gladisphilippine cedarphase modulationovulation methodoverhead railwayorder phalangidaorder orchidalesorder lichenalesorder helotialesoliver heavisidenorthern irelandmordecai richlermitella diphyllamichaelmas daisymichael e. debakeymethacrylic acidmercury chloridemaxfield parrishmaryland chickenmarlene dietrichmaleic hydrazidemachine readablelowland white firlightly armouredlepiota rhacodeslaw of archimedeslady with the lampladder-back chairkurdish languagekepler's third lawkahoolawe islandjointed charlockiron perchlorideindian chocolatehydrogen sulfidehydraulic systemhydraulic cementhydraulic brakeshydrangea familyhyaloid membranehordeum pusillumhomogenized milkholbein the elderhidatsa languageheraldic bearinghenry i of englandhenri van de veldehelladic cultureheavily traveledhead-in-the-cloudshead for the hillshammer and sicklehall of residencehaldea striatulahairy darling peagreen apple aphidgolden chinkapingenus phlebodiumgenus drosophilagenus dolichotisgenus dolichonyxgarden symphilidfriendship plantforked lightningflight attendantflathead catfishfield hockey ballfamily ziphiidaefamily xiphiidaefamily thripidaefamily tethyidaefamily sphecidaefamily phyllidaefamily phillidaefamily phasmidaefamily hydnaceaefamily hyaenidaefamily homaridaefamily helicidaefamily cichlidaefamily chermidaefamily chalcidaefamily bruchidaefamily anhimidaeexhaust manifoldethmoidal arteryethanoyl radicalepidemic choleraenglish lady crabenglish foxhoundedible sea urchindutch elm diseasedog's-tooth violetdisability checkdental hygienistdental handpiecedaisy print wheelcrown-of-the-fieldclass echinoideaclammy chickweedcigarette holderchurch of irelandchoroidal arterychlorine dioxidechlorinated limechemical defencececil john rhodescartridge holdercanadian hemlockcalcium chloridecadmium sulphidebullhead catfishbornholm diseaseblue-headed vireobleaching powderblack rudderfishblack nightshadebelgian sheepdogarmoured vehiclearchibald wavell
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen