Dictionary Only:
Profanity Off:

15-Letter Words Containing: D,E,E,N,P,_

 (In Any Order)
There are 209 15 letter words, 188 15 letter phrases and 0 15 letter abbr's with D,E,E,N,P,_ in.

Best Scoring

Expand?WordSave?LengthUsagePointsType
benzodiazepines15
38 nounn
noun

• any of several similar lipophilic amines used as tranquilizers or sedatives or hypnotics or muscle relaxants; chronic use can lead to dependency

hypersensitized15
33 adjectiveadj
adjective satellite

• having an allergy or peculiar or excessive susceptibility (especially to a specific factor)

underemphasized15
33 adjectiveadj
adjective

• Insufficiently emphasized

haphazardnesses15
33
noun

• the quality of lacking any predictable order or plan

underemphasizes15
32 verbv
verb

• To place insufficient emphasis on.

underpublicized15
32 adjectiveadj
Valid word for Scrabble US
adenohypophyses15
32 nounn
noun

• the anterior lobe of the pituitary body; primarily glandular in nature

pinealectomized15
31 adjectiveadj
Valid word for Scrabble US
noncomputerized15
31 adjectiveadj
Valid word for Scrabble US
diphenhydramine15
30 nounn
noun

• antihistamine (trade name Benadryl) used to treat allergic reactions involving the nasal passages (hay fever) and also to treat motion sickness

or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 15 Letter Words

Words (209)
underprivilegeddevelopmentallypseudoephedrineuninterruptedlymethylphenidateunprecedentedlyinterdependenceuncomprehendinginterdependencydiphenhydraminesuperintendenceperpendicularlyhypersensitizedexpeditiousnesscomplicatednessacetophenetidinunderemphasizesunderemphasizedunchoreographedsuperintendentsserendipitouslypseudoscientistpremanufacturedprekindergartenpredestinarianspreadolescencespigheadednessesphotosensitizedoverrepresentedopenmouthednessopenheartednessmisapprehendingdescriptivenessdepartmentalizedecompensationsdeceptivenessescyproheptadinescompendiousnessbenzodiazepinesaminopeptidasesunderpublicizedunderemploymenttransparentizedsuperintendencysuperheterodynesuperconductivesupercalenderedsuperabundancessubdevelopmentssplendiferouslyseptendecillionradiotelephonespseudopregnancypseudepigraphonproletarianizedproletarianisedprepresidentialpreponderationspreponderanciesprejudicialnesspredestinationspossessednessesponderousnessespolynucleotidespinheadednessespinealectomizedpervertednessespendulousnessesoveropinionatedoverdevelopmentoverdependencesovercompensatedopinionatednessnonreproductivenonindependencenonencapsulatednondevelopmentsnondepartmentalnoncomputerizedlymphadenitisesinterpenetratedhyperventilatedhypermodernistshaphazardnessesfibrinopeptidesexpendabilitiesexpandabilitiesdisparatenessesdesperatenessesdepigmentationsdepersonalizingdependabilitiesdaguerreotypingcounterpicketedcorrespondencesantidevelopmentantidepressantsadenohypophysesdessertspoonfulsuperencipheredpredevaluationspostadolescentsnonreproducibleantidepressionsvideotelephonesvespertilionidsunsuspectednessunspottednessesunpremeditationunpractisednessunderpublicisedunderperformingunderemphasisesunderemphasisedunderdevelopingundercapitalizeundercapitalisetransportednesstransparentisedsuspectednessessuperinducementsuperconfidencestilpnosideritesimplicidentatepseudomembranesprudentialitiespredictablenesspredevelopmentspredeterminismspredeterminablepredesignationspredatorinessesponderabilitiespolyvinylidenespinealectomisedphotosensitisedphotoluminescedperplexednessesperiodontitisesperfervidnessespedestrianizingpedestrianisingpedagoguishnessnondescriptnessnoncomputerisedmiscomprehendedlepidodendroidsinterpunctuatedimpassionednessequiponderatingequiponderancesepicondylitisesencyclopaedistsencyclopaedismsdisputativenessdisplenishmentsdispleasingnessdispersednessesdisempowermentsdiphenylketonesdiphenyleniminedexamphetaminesdepersonalisingdepartmentalismdepartmentalisecyclopentadienecounterpleadingcorrespondentlycomplexednessescompactednessescinematographedchenopodiaceousbespottednessesapprenticehoodsaerohydroplanesadaptablenessesunprotectednessundependabilityuncompartmentedtorpediniformessupersensitizedsupersensitisedstenopelmatidaeself-opinionatedself-disciplinedself-descriptionself-deprecatingradiotelephonicpseudomonadalespropionaldehydeprice-controlledpinkish-lavenderphenylacetamidephenazopyridinepetromyzontidaepaleodendrologymanic-depressivelow-spiritednesslepidodendraleshypersensitisedhyperadrenalismhearing-impairedgenus-megapodiusdispensablenessctenocephalidesclosed-captionedceratopogonidaebalaenopteridaeantheridiophore
Phrases (188)
windscreen wiperunskilled personstate departmentspiny-headed wormsound perceptionslender lady palmpresident wilsonpresident hooverpresident carterpoitrine d'agneauphyseter catodonorder sapindalesneedle spike rushmedicare paymentlocal departmentlabor departmentjuan ponce de leonjohnny appleseedindependence daygreen peach aphidgenus priodontesgenus lycoperdongenus lophodytesgenus epidendrumgenus dipladeniagenus delphiniumgenus asphodelusdisplaced persondispersing phasediospyros ebenumdepartment storedental appliancedementia praecoxdaphne du mauriercurlew sandpipercomputing devicecaudal appendagecapital of swedenbirthday presentbelgian shepherdacer platanoideswindshield wiperwhitebarked pinewhite dipladeniaundirected graphtrade protectiontrade acceptancetongue depressortax depreciationtappan zee bridgesynapsid reptilesuperoxide anionstephen sondheimstephen jay gouldstephen a. douglassteel productionspecial pleadingsnowdrop anemoneslender knapweedsleeping draughtseward peninsulasales departmentpunitive damagespudding pipe treepublic knowledgeprivet andromedapresident trumanpresident taylorpresident reaganpresident piercepresident monroepresident arthurpowder techniquepope benedict xivpope alexander vipolyhedral angleplant departmentpinus cembroidespink sand verbenapin-tailed grousepiedmont glacierphilippine cedarpericardial veinperformance bondpeppermint candypenstemon doliuspencil cedar treepecten irradiansparts departmentpainted tortoisepainted terrapinorder sphagnalesorder pandanalesorder opuntialesorder neuropteraoperating budgetold-age pensionernewspaper editorneuroleptic drugmusic departmentminiature poodlemeat and potatoesmanic depressionlunar time periodlobed spleenwortline-drive triplelegal proceedinglearned responseland developmentkorean lespedezakippered herringjohn hoyer updikejapanese red pinejapanese red armyjapanese islandsisland dispenseriron perchlorideinterrupted ferninfrared therapyhigh-protein dietgreen woodpeckergreen apple aphidgreater knapweedgreat depressiongraphic designergrade separationgolden parachutegestation periodgerman police doggenus spodopteragenus pseudechisgenus pseudacrisgenus pontederiagenus pomaderrisgenus piptadeniagenus phyllodocegenus phlebodiumgenus peridiniumgenus pedionomusgenus hyperoodongenus dryopterisgenus dipteroniagenus dendraspisgenus decapterusgenus aspidelapsgarden centipedefield pennycressevoked potentialeuropean wildcatequine distemperects-credit pointduplex apartmentdrop in the bucketdowny woodpeckerdouble pneumoniadomestic partnerdobereiner's lampdipterous insectdiane de poitiersdependent clausedeparture loungedental proceduredental handpiecedeficit spendingdeferred paymentdata input devicedaisy print wheelcotes de provenceconsumption weedcommon speedwellchelate compoundcapeline bandagecape sable islandcanine distempercandlepower unitcanadian red pinebypass condenserbuffered aspirinbleaching powderbigtoothed aspenbig-toothed aspenbenzoyl peroxidebelgian sheepdogbanded palm civetasplenium virideamerican red plumalpine goldenrodabandoned person
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen