Dictionary Only:
Profanity Off:

15-Letter Words Containing: D,E,E,I,P

 (In Any Order)
There are 246 15 letter words, 207 15 letter phrases and 0 15 letter abbr's with D,E,E,I,P in.

Best Scoring 15 Letter Words With: D,E,E,I,P

Expand?WordSave?LengthUsagePointsType
benzodiazepines15
38 nounn
noun

• any of several similar lipophilic amines used as tranquilizers or sedatives or hypnotics or muscle relaxants; chronic use can lead to dependency

hypersensitized15
33 adjectiveadj
adjective satellite

• having an allergy or peculiar or excessive susceptibility (especially to a specific factor)

underemphasized15
33 adjectiveadj
adjective

• Insufficiently emphasized

overspecialized15
32 adjectiveadj
verb

• To specialize to an excessive degree.

underemphasizes15
32 verbv
verb

• To place insufficient emphasis on.

underpublicized15
32 adjectiveadj
Valid word for Scrabble US
overcapitalized15
32 adjectiveadj
verb

• estimate the capital value of (a company) at an unreasonably or unlawfully high level

• overestimate the market value of

• capitalize beyond what the business or the profit-making prospects warrant

psychedelically15
31 adverb, adjectiveadv, adj
Valid word for Scrabble US
pinealectomized15
31 adjectiveadj
Valid word for Scrabble US
noncomputerized15
31 adjectiveadj
Valid word for Scrabble US
or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 15 Letter Words

Words (246)
underprivilegeddisrespectfullypseudoephedrineoverspecializeduninterruptedlymethylphenidateinterdependenceepidemiologicaluncomprehendinginterdependencydiphenhydraminesuperintendenceperpendicularlyhypersensitizedexpeditiousnesscomplicatednessacetophenetidinunderemphasizesunderemphasizedsuperintendentsserendipitouslyrespiritualizedpsychedelicallypseudoscientistprekindergartenpredestinarianspoliomyelitidespigheadednessesphotosensitizedovercomplicatedmisapprehendinghyperstimulateddespiritualizesdespiritualizeddescriptivenessdepartmentalizedecompensationsdeceptivenessesdaguerreotypistcyproheptadinescompendiousnessbenzodiazepinesaminopeptidasesunderpublicizedtransparentizedthermoperiodismsuperstimulatedsuperintendencysuperfluiditiessuperconductivespreadabilitiessplendiferouslyseptendecillionreduplicativelyradiotelephonesradiotelegraphsradioprotectivepseudepigraphonproletarianizedproletarianisedprepresidentialpreponderationspreponderanciesprejudicialnesspredestinationspostdivestiturepolynucleotidespinheadednessespinealectomizedperdurabilitiesparallelepipedsoveropinionatedovercapitalizedopinionatednessnonreproductivenonindependencenoncomputerizedlymphadenitisesinterpenetratedhyperventilatedhypermodernistshyperlipidemiasheadmastershipsfibrinopeptidesexpendabilitiesexpandabilitiesepidemiologistselectrodepositsdistemperaturesdisparatenessesdepigmentationsdepersonalizingdependabilitiesdaguerreotypingdaguerreotypiescounterpicketedantidevelopmentantidepressantsradiotelegraphylepidopterologysuperencipheredpredevaluationsnonreproducibleantidepressionsvideotelephonesvespertilionidsunpremeditationunpractisednessunderpublicisedunderperformingunderemphasisesunderemphasisedunderdevelopingundercapitalizeundercapitaliseultracrepidatesultracrepidatedtransparentisedsuperinducementsuperficializedsuperficialisedsuperconfidencesulphacetamidesstilpnosideritespheroidicitiessphaerosideritesimplicidentatesesquisulphidesrespiritualisedrespectabilizedrespectabilisedpseudepigraphicpseudaesthesiasprudentialitiespredictablenesspredicabilitiespredeterminismspredeterminablepredesignationspredatorinessesponderabilitiespolyvinylidenespinealectomisedphotosensitisedphotoluminescedperissodactylesperiodontitisesperfervidnessespedestrianizingpedestrianisingpedagoguishnessparallelopipedsparallelopipedaparallelepipedaoverspecialisedovercapitalisedoophorectomizedoophorectomisednondescriptnessnoncomputerisedmiscomprehendedlepidodendroidsinterpunctuatedimpassionednesshypercriticizedhypercriticisedhouseholdershipgeodemographicsequiponderatingequiponderancesepicondylitisesencyclopaedistsencyclopaedismsdisputativenessdisplenishmentsdispleasingnessdispersednessesdisempowermentsdiphenylketonesdiphenyleniminedexamphetaminesdespiritualisesdespiritualiseddespicabilitiesdermatoplastiesdermatographiesdeplorabilitiesdephlogisticatedepersonalisingdepartmentalismdepartmentalisedecipherabilitydeceptibilitiescyclopentadienecounterpleadingcinematographedchenopodiaceouscercopithecoidsapprenticehoodsweather-strippedundependabilitytorpediniformessupersensitizedsupersensitisedstenopelmatidaeself-opinionatedself-disciplinedself-descriptionself-deprecatingsciadopityaceaeradiotelephonicpterodactylidaepropionaldehydeprice-controlledplatycephalidaepinkish-lavenderphiladelphaceaephenylacetamidephenazopyridinepetromyzontidaeorycteropodidaemyrmecophagidaemanic-depressivelow-spiritednessleptodactylidaelepidodendraleshypersensitisedhyperlipoidemiahyperlipidaemiahyperadrenalismhighly-developedhearing-impairedgomphotheriidaegenus-megapodiusgasterophilidaeelectrophoridaedryopteridaceaedispensablenessdactylopteridaectenocephalidesclosed-captionedcercopithecidaeceratopogonidaebalaenopteridaeasclepiadaceousantheridiophore
Phrases (207)
windscreen wiperwhited sepulchrewhited sepulcherunskilled persontime of departurespiny-headed wormsound perceptionsecurity depositpsychedelic drugpresident wilsonpresident hooverpresident carterpolice detectivepoitrine d'agneauorder sapindalesorder chiropteraneedle spike rushmedicare paymentindependence daygreen peach aphidgenus priodontesgenus epidendrumgenus dipladeniagenus delphiniumfamily leporidaeedible asparagusdomestic prelatedisplaced persondispersing phasediospyros ebenumdental appliancedementia praecoxdata multiplexerdaphne du maurierdame muriel sparkcurlew sandpipercomputing devicecapital of swedenbirthday presentbelgian shepherdadhesive plasteracer platanoideswindshield wiperwhitebarked pinewhite dipladeniaundirected graphtrade protectiontax depreciationtappan zee bridgesynapsid reptilesuperoxide anionstriped squirrelstephen sondheimsteel productionspotted weakfishspiritual leaderspecial pleadingspecial deliveryspeak of the devilsleeping draughtseward peninsulaseidlitz powderssacred scripturereuters dispatchpunitive damagespullorum diseasepudding pipe treepublic knowledgepterygoid plexuspterygoid musclepsychedelic rockprivet andromedapresident trumanpresident taylorpresident reaganpresident piercepresident monroepresident arthurpowder techniquepope benedict xivpope alexander vipolitical leaderpinus cembroidespink sand verbenapin-tailed grousepierre de terrailpieris protodicepierid butterflypiedmont glacierpied-billed grebepicris echioidesphilippine cedarpericardial veinpeppermint candypenstemon doliuspencil cedar treepecten irradianspasteurized milkpainted tortoisepainted terrapinpacific tree toadorder therapsidaorder psilotalesorder primulalesorder piciformesorder pediculatiorder parietalesorder opuntialesorder ephemeridaorder embiopteraorder cydippideaoperating budgetold-age pensionernewspaper editorneuroleptic drugmusic departmentminiature poodlemicroscope slidemedical practicemeadow spikemossmanic depressionlunar time periodline-drive triplelepiota rhacodeslegal proceedingkippered herringkepler's third lawjohn hoyer updikejapanese red pinejapanese islandsisland dispenseriron perchlorideinterrupted ferninfrared therapyhigh-protein dietgreen apple aphidgreat depressiongraphic designergrade separationgestation periodgerman police doggerard depardieugenus pseudechisgenus pseudacrisgenus pontederiagenus pomaderrisgenus piptadeniagenus phlebodiumgenus peridiniumgenus pedionomusgenus dryopterisgenus dipteroniagenus dendraspisgenus aspidelapsgarden centipedeforceps deliveryfive spice powderfield pennycressfederalist partyfamily viperidaefamily sphecidaefamily pteriidaefamily proteidaefamily ploceidaefamily meropidaefamily lepadidaefamily clupeidaeexplosive deviceevoked potentialeuropean wildcatequine distemperepidemic roseolaepidemic myalgiaepidemic diseaseepidemic choleraedible-podded peaects-credit pointdrop in the bucketdouble pneumoniadomestic partnerdobereiner's lampdipterous insectdiane de poitiersderris ellipticadental handpiecedeficit spendingdata input devicedaisy print wheelconsumption weedcapeline bandagecape sable islandcanine distempercandlepower unitcanadian red pinebuffered aspirinbleaching powderbigtoothed aspenbig-toothed aspenbenzoyl peroxidebelgian sheepdogbanded palm civetastreus pteridisasplenium virideasclepias meadiiamerican red plumalpine goldenrodaedes albopictus
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen