15-Letter Words Containing: A,H,N,P,R,S,Y
(In Any Order)
There are 43 15 letter words,
26 15 letter phrases and
0 15 letter abbr's with
A,H,N,P,R,S,Y in.
Best Scoring
Expand? | Word | Save? | Length | Usage | Points | Type | ||
---|---|---|---|---|---|---|---|---|
psychometrician | 15 | 29 | nounn | |||||
noun • A person who administers psychometric tests. | ||||||||
hypervigilances | 15 | 29 | nounn | |||||
Valid word for Scrabble US
| ||||||||
phosphorylating | 15 | 29 | verbv | |||||
verb • To cause phosphorylation • To undergo phosphorylation adjective • That phosphorylates. | ||||||||
lymphangiograms | 15 | 29 | nounn | |||||
noun • an angiogram of the lymph nodes and lymph vessels made after the injection of a radiopaque substance | ||||||||
hypochondriases | 15 | 29 | noun, adjectiven, adj | |||||
noun • chronic and abnormal anxiety about imaginary symptoms and ailments | ||||||||
hypochondriasis | 15 | 29 | nounn | |||||
noun • chronic and abnormal anxiety about imaginary symptoms and ailments | ||||||||
neuropsychiatry | 15 | 28 | nounn | |||||
noun • the branch of medicine dealing with mental disorders attributable to diseases of the nervous system | ||||||||
psychohistorian | 15 | 28 | noun, adjectiven, adj | |||||
Valid word for Scrabble US
| ||||||||
cyproheptadines | 15 | 28 | ||||||
noun • an antihistamine (trade name Periactin) used to treat some allergic reactions | ||||||||
semipornography | 15 | 28 | noun, adjectiven, adj | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
All 15 Letter Words
Words (43)
neuropsychiatryultrasonographypsychometricianpsychohistorianhypervigilanceshypersalivationcyproheptadinessemipornographyphosphorylationphosphorylatingphenylthioureasnonpsychiatristlymphangiogramsionosphericallyhypochondriaseshypnotherapistshyperventilateshypersalinitieshyperinflationshypochondriasistriphenylaminessulphinpyrazonepyrotechnicianspsychoanalyzerspsychoanalysersprosenchymatouspharyngoscopiespharyngologistshypomenorrhoeashypocrystallinehypochondriastshypochondriasmshyperpolarisinghypernatraemiashalfpennyworthsbrachypinakoidsanthropopsychicandrogynophoresaerohydroplanespanhysterectomyhyperadrenalismcryptacanthodescampylorhynchusPhrases (26)
spiny-headed wormshorthand typistscholarly personphyseter catodongenus hyalophorabirthday presentnews photographyinky-cap mushroomhyponitrous acidhypogastric veingenus syrrhaptesgenus pyracanthagenus pternohylagenus psychotriagenus porphyrulagenus phylloxeragenus phrynosomagenus paronychiagenus lactophrysgenus hyphantriagenus cystophoragarden symphilidfrench polynesiadaisy print wheelaversion therapyallegheny spurge