15-Letter Words Containing: A,E,H,N,P,R,T,Y
(In Any Order)
There are 34 15 letter words,
22 15 letter phrases and
0 15 letter abbr's with
A,E,H,N,P,R,T,Y in.
Best Scoring 15 Letter Words With: A,E,H,N,P,R,T,Y
Expand? | Word | Save? | Length | Usage | Points | Type | ||
---|---|---|---|---|---|---|---|---|
pyrotechnically | 15 | 30 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
hematoporphyrin | 15 | 30 | nounn | |||||
Valid word for Scrabble US
| ||||||||
psychometrician | 15 | 29 | nounn | |||||
noun • A person who administers psychometric tests. | ||||||||
neuropsychiatry | 15 | 28 | nounn | |||||
noun • the branch of medicine dealing with mental disorders attributable to diseases of the nervous system | ||||||||
uncopyrightable | 15 | 28 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
hyperfunctional | 15 | 28 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
cyproheptadines | 15 | 28 | ||||||
noun • an antihistamine (trade name Periactin) used to treat some allergic reactions | ||||||||
hypnotherapists | 15 | 28 | nounn | |||||
Valid word for Scrabble US
| ||||||||
hyperventilated | 15 | 27 | verb, adjectivev, adj | |||||
verb • produce hyperventilation in • breathe excessively hard and fast | ||||||||
phenylketonuria | 15 | 27 | nounn | |||||
noun • a genetic disorder of metabolism; lack of the enzyme needed to turn phenylalanine into tyrosine results in an accumulation of phenylalanine in the body fluids which causes various degrees of mental deficiency | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
All 15 Letter Words
Words (34)
parentheticallyneuropsychiatryuncopyrightablepsychometricianhypersalivationhyperfunctionalcyproheptadinespyrotechnicallyphenylthioureasneuropathicallyhypnotherapistshyperventilateshyperventilatedhypersalinitieshyperinflationshematoporphyrinroentgenographyphenylketonuriatriphenylaminesrontgenotherapypyrotechniciansprosenchymatouspolychlorinatedpalaeontographyhypocrystallinehypernatraemiashalfpennyworthspentaerythritolpanhysterectomypaleornithologyhypoproteinemiacryptacanthodesconiferophytinaacanthopterygiiPhrases (22)
rhythmic patternphyseter catodonbirthday presentxerophytic plantphylum nemertinanymphaea odoratanews photographyinfrared therapyhypogastric veinhyphantria cuneagenus syrrhaptesgenus pyracanthagenus pternohylagenus psychotriagenus lactophrysgenus hyphantriagenus cystophoradaisy print wheelaversion therapyanthony trollopeantheraea pernyianchovy pear tree