15-Letter Words Containing: _,_,D,E,H,L,P,S
(In Any Order)
There are 48 15 letter words,
41 15 letter phrases and
0 15 letter abbr's with
_,_,D,E,H,L,P,S in.
Best Scoring
Expand? | Word | Save? | Length | Usage | Points | Type | ||
---|---|---|---|---|---|---|---|---|
hydroxyprolines | 15 | 34 | nounn | |||||
noun • a crystalline amino acid obtained from gelatin or collagen | ||||||||
psychedelically | 15 | 31 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
nonhospitalized | 15 | 30 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
hydrocephaluses | 15 | 29 | nounn | |||||
Valid word for Scrabble US
| ||||||||
dephosphorylate | 15 | 29 | verbv | |||||
Valid word for Scrabble US
| ||||||||
dermatoglyphics | 15 | 29 | nounn | |||||
noun • the study of the whorls and loops and arches in the fingertips and on the palms of the hand and the soles of the feet | ||||||||
polysaccharides | 15 | 28 | nounn | |||||
noun • any of a class of carbohydrates whose molecules contain chains of monosaccharide molecules | ||||||||
hyperlipidemias | 15 | 28 | nounn | |||||
noun • presence of excess lipids in the blood | ||||||||
chlorpropamides | 15 | 27 | nounn | |||||
Valid word for Scrabble US
| ||||||||
sophisticatedly | 15 | 26 | adverbadv | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
All 15 Letter Words
Words (48)
sophisticatedlypsychedelicallypolysaccharideshyperstimulatedelectrophoresedstadtholdershipradiotelephonesradiotelegraphsphotoduplicatesnonhospitalizedlymphadenitiseshyperlipidemiashydroxyprolineshydrocephalusesdephosphorylatechlorpropamidesamphidiploidiesdermatoglyphicsvideotelephonessulphanilamidessulphacetamidesstadholdershipssesquisulphidespteridophilistspsychodelicallyphotoluminescedphotoelectrodesornithodelphousnonhospitalisedlipodystrophieshouseholdershipgoodfellowshipsedriophthalmousdisplenishmentsdiphenylketonesdiaheliotropismdesulphurationsdephlogisticatedactylographiesdactylographersaerohydroplanespinkish-lavenderhyperadrenalismhourglass-shapedhippoglossoidesgasterophilidaectenocephalidesbutterfly-shapedPhrases (41)
whited sepulchrewhited sepulcherpsychedelic drugneedle spike rushjohnny appleseedgenus lophodytesgenus delphiniumgenus asphodelusbelgian shepherdadhesive plasterwindshield wiperstephen jay gouldstephen a. douglasspruce gall aphidspeak of the devilslough of despondsleeping draughtsir philip sidneypsychodelic drugpsychedelic rockpsephurus gladisphase modulationorder sphagnalesmaxfield parrishlepiota rhacodeskepler's third lawhordeum pusillumgenus phyllodocegenus phlebodiumgenus drosophilagarden symphilidfriendship plantfamily sphecidaefamily phasmidaefalse beachdropsdwarf sperm whaledepth psychologydaisy print wheelcadmium sulphidebell-shaped curvebelgian sheepdog