14-Letter Words Containing: P,E,G,G
(In Any Order)
There are 54 14 letter words,
66 14 letter phrases and
0 14 letter abbr's with
P,E,G,G in.
Best Scoring
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| prizefightings | 14 | 33 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| phytogeography | 14 | 32 | nounn | |||||
noun • The science that studies the geographical distribution of plants; geobotany | ||||||||
| zoogeographies | 14 | 30 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| zoogeographers | 14 | 30 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| fingerpickings | 14 | 27 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| geographically | 14 | 26 | adverb, adjectiveadv, adj | |||||
adverb • with respect to geography | ||||||||
| choreographing | 14 | 26 | verbv | |||||
verb • compose a sequence of dance steps, often to music • plan and oversee the development and details of | ||||||||
| paleogeography | 14 | 26 | nounn | |||||
noun • the study of the geography of ancient times or ancient epochs | ||||||||
| photoengraving | 14 | 24 | nounn | |||||
noun • an engraving used to reproduce an illustration | ||||||||
| preprogramming | 14 | 24 | noun, adjectiven, adj | |||||
verb • To program something in advance. • To predispose to certain thoughts or behaviours. | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 14 Letter Words
Words (54)
geographicallyfingerprintingphotoengravingmegasporangiumstereographingpredesignatingglossographerschoreographingzoogeographieszoogeographersprotolanguagesprizefightingspriggishnessespreregisteringpreprogrammingphytogeographyphotogeologistphotogeologiespettifoggeriesoverprograminggraspingnessesgelandesprungsfingerpickingsbiogeographiesbiogeographerspaleogeographypredischargingsupererogatingsteganographicsteganographerrontgenographyrontgenographsroentgenographprenegotiatingphrenologizingphrenologisingpharyngologiesorganographiesglyptographiesglyptographersglyphographiesglyphographersglossographiesgeomorphogenicenigmatographydisprivilegingspring-cleaninggerman-speakinggeomorphologicgaelic-speakingfingerspellingfingerpointingfinger-pointingfinger-paintingPhrases (66)
regular polygonpowdered gingerpitching changepingpong paddlepercentage signnepali languagemarkup languagelappic languagegeographic areagenus polygonumgenus phalangergenus petrogalegenus negapriongenus megapteragenus gymnogypsgenus gossypiumgenus galeopsisgenus fagopyrumgenus agapornisspoken languageselkup languagescript languagesauvignon grapereading programposthole diggerpost-hole diggerpope gregory xvipope gregory xiipope gregory viipolygala senegapolish languagepokomo languageplea bargainingpawnee languagepatwin languagepashtu languagepashto languagepapuan languagepalaic languagepaiute languagegreek partridgegrampus griseusgive-up the ghostgenus synagropsgenus spirogyragenus spilogalegenus setophagagenus polygoniagenus polyergusgenus pinguinusgenus pagophilagenus musophagagenus malpighiagenus gomphrenagenus geophilusgenus calopogongenus asparagusgenus agropyrongathering placefinger spellingespionage agentcorypha gebangacoptic languagecocopa languagecape hunting dogapache language
