14-Letter Words Containing: NY
(In Exact Order)
There are 25 14 letter words,
50 14 letter phrases and
0 14 letter abbr's with
NY in.
Best Scoring 14 Letter Words With: NY
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| phenylbutazone | 14 | 33 | nounn | |||||
noun • anti-inflammatory drug (trade name Butazolidin) | ||||||||
| nymphomaniacal | 14 | 28 | adjectiveadj | |||||
adjective satellite • (used of women) affected with excessive sexual desire | ||||||||
| phenylephrines | 14 | 27 | nounn | |||||
noun • a powerful vasoconstrictor used to dilate the pupils and relieve nasal congestion | ||||||||
| diphenylamines | 14 | 25 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| pseudonymously | 14 | 25 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| phenylthiourea | 14 | 25 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| radiotelephony | 14 | 23 | noun, adjectiven, adj | |||||
noun • telephony that uses transmission by radio rather than by wire | ||||||||
| pseudonymities | 14 | 22 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| phenylalanines | 14 | 22 | nounn | |||||
noun • an essential amino acid found in proteins and needed for growth of children and for protein metabolism in children and adults; abundant in milk and eggs; it is normally converted to tyrosine in the human body | ||||||||
| carbonylations | 14 | 21 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 14 Letter Words With NY In Order
Words (25)
nymphomaniacaldiphenylaminescarbonylationspseudonymouslypseudonymitiesphenylthioureaphenylephrinesphenylalaninesradiotelephonyphenylbutazonetriphenylaminesulphonylureaspolyvinylideneonychophagistsnyctaginaceousheteronymouslydiphenylketoneanythingariansunyieldingnesssynonymousnessshove-halfpennyphenylethylenemegalonychidaehalfpennyworthchoeronycterisPhrases (50)
victoria nyanzatrionyx muticustheater companypolyvinyl resinlimited companylaw of parsimonygenus nymphicuscapital of kenyaanthony vandykeanthony van dyckanthony burgessalfred tennysonturn a nice pennythorny amaranthtammany societyspiny softshellsapele mahoganyromany languageremoval companyplymouth colonypenny ante pokerpanonychus ulmiorbignya cohunenyssa sylvaticanizhny novgorodmusical harmonymahogany familylake tanganyikakenyan shillingjasminum mesnyiictonyx striataictonyx frenatahorny structureholding companyherpestes nyulagranny's bonnetsgenus onychomysgenus nymphalisgenus nyctimenefinance companyeightpenny naildowny manzanitadittany of cretecataract canyoncanyon treefrogbunya bunya treebanking companyanthony hopkinsallegheny riveralizarin yellow
