Dictionary Only:
Profanity Off:

14-Letter Words Containing: H,I,L,N

 (In Any Order)
There are 551 14 letter words, 380 14 letter phrases and 0 14 letter abbr's with H,I,L,N in.

Best Scoring 14 Letter Words With: H,I,L,N

Expand?WordSave?LengthUsagePointsType
psychologizing14
35 verb, nounv, n
verb

• To interpret or analyze in psychological terms

noun

• Psychological analysis or interpretation.

philosophizing14
34 verb, nounv, n
noun

• the exposition (often superficially) of a particular philosophy

xenophobically14
33 adverb, adjectiveadv, adj
Valid word for Scrabble US
hydroxylamines14
33 nounn
Valid word for Scrabble US
hydroxyproline14
33 nounn
noun

• a crystalline amino acid obtained from gelatin or collagen

chlorpromazine14
32 nounn
noun

• a drug (trade name Thorazine) derived from phenothiazine that has antipsychotic effects and is used as a sedative and tranquilizer

methylxanthine14
32 nounn
Valid word for Scrabble US
oxyhemoglobins14
32 nounn
noun

• the bright red hemoglobin that is a combination of hemoglobin and oxygen from the lungs

lyophilization14
31 verb, nounv, n
noun

• a method of drying food or blood plasma or pharmaceuticals or tissue without destroying their physical structure; material is frozen and then warmed in a vacuum so that the ice sublimes

technicalizing14
31 verbv
Valid word for Scrabble US
or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 14 Letter Words

Words (551)
rehabilitationaccomplishmentpsychoanalysisanthropologistphilanthropistoverwhelminglyhallucinogeniccomprehensibleschoolchildrencholinesterasehyperventilatephilosophizingindecipherablepsychoanalyticunfaithfulnessornithologicalweightlessnessrehabilitatingschoolteachingrelinquishmentunaccomplishedunthinkabilitymechanicalnessinheritabilityunenlighteningpyelonephritishospitablenessbronchodilatortelephonicallyphilosophisingneighborlinesschlorpromazineethnologicallyunhesitatinglynymphomaniacalmalnourishmentanesthesiologyundecipherablethriftlessnessrhinencephalonoutlandishnessmethodicalnesslyophilizationcomprehendiblechannelizationalphanumericalwoolgatheringsunderclothingsthyroglobulinstechnicalitiessycophantishlysilversmithingreupholsteringreplenishmentsreestablishingpsychologizingplatyhelminthsphilhellenistsphilanthropoidnonperishablesmonolithicallymischannellingmethylxanthinemachineabilitymachicolationslithificationslichenologicallaughingstockslandownershipslamellibranchsinharmoniouslyiconographicalhypoallergenichypervigilancehypermasculinehydrodynamicalhumanisticallyhistrionicallyhedonisticallyhairsplittingsfellowshippingexhilaratinglyestablishmentsepithelizationenlightenmentsembellishmentselectrofishingdiphenylaminesdevilishnessesdelightfulnesscomprehensiblyclearinghouseschurlishnesseschivalrousnessbreathtakinglyblacksmithingsantidiarrhealsaminophyllinesworthwhilenessunchivalrouslyextinguishablecharitablenessantiphlogisticxenophobicallyworshipfulnesswheelbarrowinguntouchabilityunhystericallyunemphaticallytrothplightingtrihalomethaneticklishnessesthimbleriggingthiabendazolesthermalizationthanatologiststhanatologicaltechnologizingtechnicalizingsynchronicallysubarachnoidalsteeplechasingstealthinessessprightfulnesssluggishnessesshuttlecockingrightfulnessesrhinencephalicquintillionthsqualmishnessesquadrillionthspyroninophilicpyelonephriticpsychologisingprothonotarialprosencephalicproconsulshipsprincipalshipsprehensilitiesplaywrightingsphysiognomicalphysicalnessesphthalocyaninephotogenicallyphonologicallyphilhellenismsphilanthropiesphenylthioureaphenylephrinesphenylalaninesphenotypicallyphenomenalistsphenomenalismsphenologicallyphenobarbitalsphencyclidinespamphleteeringoxyhemoglobinsorthogonalizesorthogonalizedornithologistsorganochlorinenontheoreticalnontheologicalnonphilosophernonestablishedneurochemicalsnephelometriesnaphthylaminesmyelencephalicmotherlinessesmonotheisticalmonophonicallymirthfulnessesmethemoglobinsliverishnesseslichenologistslibrarianshipsknightlinesseskeratinophilicinterparochialinapproachablehypersonicallyhyperinflationhyperemotionalhydroxylationshydroxylamineshydroponicallyhyaluronidaseshousecleaningshorriblenesseshonorabilitieshemoglobinurichemagglutininshellenizationsheavenlinessesheartrendinglyhalterbreakinghallucinationshairlessnesseshabitualnessesghoulishnessesgeochronologicfreewheelinglyflugelhornistsfatherlinessesfashionabilityfaithfulnessesfaintheartedlyethnobotanicalenharmonicallyendotheliomataencephalitogenencephalitidesearthshakinglydisenthrallingdinitrophenolsdichloroethanediachronicallydechlorinationdechlorinatingcounselorshipsconsultantshipcollieshangiesclownishnessescloddishnessescliquishnessesclannishnesseschurchlinesseschronometricalchronobiologiccholestyraminecholangiogramschildishnessescephalosporinscephaloridinescephalizationscatecholaminescandlelightersblimpishnessesantitechnologyantilogarithmsantihomosexualantihistoricalantialcoholismanthropologiesanthophyllitesanestheticallyanchoriticallyanalphabetismsalmightinessesacetylcholinesthromboplastinradiotelephonyradiotelephonepsycholinguistpolyphonicallylymphangiogramlabyrinthodontimmunochemicalhydroxyprolinehistoricalnesshemoglobinuriahemagglutinateethnographicalcouncillorshipcontrollershipchancellorshipapprehensivelyantitheticallyantisyphiliticachondroplasiawhistleblowinghallucinosiseszincographicalweightliftingsvideotelephoneuranographicalunrightfulnessunrhythmicallyunmetaphysicalunmetaphoricalunmathematicalunknightlinessundiminishableunblushingnesstriphenylaminetrinitrophenoltrimethylaminetriethylaminestomfoolishnessthermalisationtheologizationtheologisationtheatricalnesstechnopolitanstechnologisingtechnicolouredtechnicalisingsyphilizationssyphilisationssulphurizationsulphurisationsulphanilamidesulphadiazinesstegocephaliansplotchinessessphingomyelinssphagnologistsslobbishnessesslipshodnessesslipshoddinessshillingsworthseneschalshipsselenographistselenographiesscenographicalrhizocephalansrhinoscleromaspsychogalvanicpsilanthropistpsilanthropismpsilanthropiespsephoanalysispostulantshipspolysynthetismpolysynthesismpolyhistoriansploughmanshipsplatyrrhiniansphytogeneticalphylloquinonesphthalocyaninsphrenologizingphrenologisingphotoluminescephonematicallyphlegmaticnessphlebotomizingphlebotomisingphenomenalizesphenomenalizedphenomenalisesphenomenalisedpharyngologistpharyngologiesphantasmicallyphallocentrismphalansteristsphalansterismsparochializingparochialisingpantographicalpantheologistspanophthalmiaspalaeanthropicorthogonalisesorthogonalisedorthogenicallyorthodiagonalsornithophilousornithophiliesornithodelphicopisthocoelianomphalomanciesnightclubbingsnemathelminthsneanderthaloidmultithreadingmonothelitismsmonotheletismsmonotheleticalmicrolightingsmethylthioninemethaemoglobinmelancholinessmegaphonicallymechanicalismsmacrencephaliamachiavellianslymphangitiseslymphangitideslycanthropistslithotritizinglithotritisinglithontriptorslithontriptistlithontripticslithonthrypticlieutenantshiplicentiateshipleucitohedronsleatherinesseslaryngophonieskinetheodoliteinhabitabilityindecipherablyinapproachablyichnographicalhyponasticallyhypomixolydianhydrolyzationshydrolysationshydrokineticalhydrogenolysishydrocorallinehyalinizationshyalinisationshuckleberryinghorripilationshorizontalnesshomophonicallyhistogenicallyhispaniolizinghispaniolisinghexactinellidsheroicalnesseshelminthologichellenisationshalfwittednesshaemagglutiningillravitchinggerontophiliasgentlemanshipsgenethlialogicgenethliacallygaleopithecinefloodlightingsethnolinguistsethnobiologiesepitrachelionsepithelisationenthymematicalenthusiasticalendophyticallyencephalitisesencephalalgiasemphaticalnessembellishinglyeleutheromaniadisplenishmentdisinthrallingdisenthralmentdiphenylketonedimethylaminesdiacatholiconsdesulphurizingdesulphurisingdesulphurationdesulphuratingdephlegmationsdaughterlinesscouncilorshipsconstableshipscoelanaglyphiccoachbuildingschylificationschronologizingchronologisingchlorocruorinschloritizationchloritisationchlorhexidineschimericalnesscharlatanisticchaptalizationchaptalisationcephalisationscentrolecithalcatechumenicalcalycanthemiescacophonicallybranchiostegalbrachydiagonalblokeishnessesblockishnessesblithesomenessblanchisseusesarchgenethliacarachnologistsarachnologicalantiphrasticalantiphonicallyantihelminthicantichloristicanthelminthicsanachronicallyalphabetariansalexipharmakonalcoholizationalcoholisationaeromechanicalwinding-clothesunvanquishableunhygienicallyunharmoniouslyunforesightfulundecipherablytechnical-gradesulfamezathinesulfamethazinestenographicalspindle-shankedsingle-handedlyself-punishmentscyliorhinidaereprehensivelyplethodontidaeplesianthropuspinwheel-shapedphalaenoptilusperishablenesspathogenicallyoxyhaemoglobinoligomenorrheanoninheritableneanderthalianmnemotechnicalmisanthropicalmegalonychidaemacrencephaliclyophilisationlufengpithecuslight-sensitiveinsightfulnesshypoadrenalismhimantoglossumhigh-resolutionhigh-principledhemoglobinemiaharlequin-snakehaplosporidiangleicheniaceaeflightlessnesselasmobranchiidolichocranialdelphinapterusdehydroretinolcynocephalidaecounsellorshipclinocephalismchrysospleniumchlorthalidonechannelisationchamaeleonidaebrownish-purplebrownish-yellowbranchiobdellaantipatheticalanthropologismalpha-terpinene
Phrases (380)
yellowish brownwrestling matchwishful thinkervena brachialistightly fittingthornton wilderthird ventriclethelonious monkteaching fellowsubalpine larchspanish capitalsir john tennielsimplex machineshellac varnishshallow fordingright ventriclerhode island redretail merchantplaning machinephysical entityphysical changephylum annelidaoriental cherrynoachian delugenational anthemmikhail bakuninmentha pulegiummalvina hoffmanmalpighian bodymale chauvinistluigi cherubinilobe-finned fishlillian hellmanlight intensitylarger-than-lifejohn tuzo wilsonirish wolfhoundhunting licensehunting licencehostile witnessholier-than-thouholding patternholding paddockhigh technologyhenri labroustehendrik lorentzheating elementharriet e. wilsonhandling chargehaitian capitalgreenish yellowgenus hamamelisgenus didelphisgenus delphinusgaston lachaisefly in the face offlight maneuverfishing licensefishing licencefisherman's lurefinnish capitalexhibition hallenglish teacherelizabethan eraelie metchnikovdimethyl ketonedante alighieridanish languageclass arachnidachinese parsleychinese lanternchimney swallowchestnut blightchemical changecharles dickenscastle in the aircapital of ghanabusman's holidaybristol channelbreathing spellbreathing placeblended whiskeybihari languagebank withdrawalball nightshadeautomobile hornamaranth familyalcoholic drinkachromatic lens24-hour intervalyellowish greenwoman's clothingwithholding taxwilliam h. bonneywilhelm von opelwhiplash injurywalpurgis nightvisible horizonvice chancellorvena trachealisunfamiliar withuighur languagetwilight visiontraining schoolthreshing floorthlaspi arvensethermal printertextile machinetelevision showtelephone kiosktassel hyacinthstillson wrenchstarting handlespiny softshellspin the platterspherical anglespanish needlessouthern lightssoft shield fernsmoothing planeskeleton shrimpsir john gielgudsir alan hodgkinsindhi languagesimon the zealotschool crossingscarlet lychnissailing warshiprussian thistlerubbing alcoholrichardson volerichard nevillerichard haldanerenal lithiasisreindeer lichenred helleborinereclining chairrail technologyquiche lorrainequiche languagepull one's weightpublishing firmprison chaplainpope john paul iipolygonal chainpolish notationpolish languageplaster machinepitch blacknesspinwheel flowerpinball machinepicnic shoulderpickled herringphylum cnidariaphonetic symbolpholiota namekophilohela minorphilippine pesophilip stanhopephilip andersonphi correlationpharyngeal veinpaul-henri thirypanonychus ulmiorthotic insoleophthalmic veinon the coattailson a higher flooroligocene epochnuclear physicsnuclear chemistnorthern oriolenorthern lightsnominal aphasianodding thistlenight blindnessnatural historynabothian glandmusical harmonymirish languagemilton s. hersheymilling machinemilking machinemikhail kalininmichael jacksonmental hospitalmedicinal leechmasculine rhymemale chauvinismmahogany familymahalia jacksonlying under oathluschka's tonsillouis the germanlistening watchlily of the incaslighter-than-airleonid brezhnevlapping machinelady-of-the-nightkuchean dialectknight bachelorkitchen utensilkenyan shillingkekchi languagekachin languagejudicial branchjohn stuart milljewish religionjewish calendariva xanthifoliairon chancelloringuinal herniaindian elephantin the public eyein a higher placei thessalonianshyla arenicolorhydnocarpus oilhyaluronic acidhungarian lilachousehold linenhorizontal tailhomogyne alpinahome equity loanholding companyhimalayan lilachimalayan cedarhillary clintonhernaria glabraherman melvilleherbal medicinehenry clay frickhenri becquerelhelix hortensishebridean islesheat of solutionheart ventriclehaversian canalhatteras islandharold nicolsonhanoverian linegulf of thailandgrass vetchlinggothic languagegolden pholiotagenus thielaviagenus stypheliagenus rhipsalisgenus phyllitisgenus pholidotagenus philohelagenus phillyreagenus philaenusgenus pagophilagenus nymphalisgenus nepheliumgenus nemophilagenus mitchellagenus megachilegenus matthiolagenus malpighiagenus linanthusgenus lichanuragenus lastheniagenus lagothrixgenus hemigalusgenus helwingiagenus heliothisgenus heliopsisgenus harpulliagenus geophilusgenus epilachnagenus colchicumgenus clianthusgenus chlamydiagenus chilopsisgenus callophisgenus callirhoegenus blephiliagenus anthyllisgenus anaphalisgenus alsophilagenus ailanthusgathic languagegathering placefully fashionedfriction clutchfrench republicfrench marigoldflying dutchmanfluid mechanicsflowering shrubflowering hazelflight engineerfinger alphabetfifth columnistfiddlehead fernevening lychnisevening clothesethmoidal sinusepiphytic plantepicanthic foldenglish sparrowenglish channelenglish bulldogelizabethan ageelizabeth setoneightpenny naildolphin strikerdelichon urbicadaylight visiondaylight savingcouncil chambercolored hearingcoleman hawkinsclose to the windclimbing helmetclass hirudineaclass channidaechurchill downschurch buildingchristian biblechinese wood oilchinese parasolchills and feverchilean jasminechief constablechemical weaponchemical energychemical actioncharlie chaplinchannel catfishchance variablechamaeleo owenichainlink fencechain lightningchadic languagecentral heatingcatherine wheelcatalina cherrycash on deliverycash equivalentcarline thistlecanadian shieldcahita languagebusiness schoolburnishing toolbranchial cleftbrahui languageborough englishboarding schoolblind stitchingblennius pholisbleaching earthbleaching agentblanching agentbirch leaf minerbill of exchangebernard hinaultberlin doughnutbelted sandfishbattle of inchonbarish languagebahamian dollarartichoke plantarthur sullivananthracite coalanthemis cotulaanimal charcoalanglican churchamerican blightalpha radiationalpha geminorumallegheny riveracyl anhydridesachilles tendonacanthus mollisacanthus familyabraham lincoln
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen