Dictionary Only:
Profanity Off:

14-Letter Words Containing: H,E,L,D

 (In Any Order)
There are 246 14 letter words, 244 14 letter phrases and 0 14 letter abbr's with H,E,L,D in.

Best Scoring 14 Letter Words With: H,E,L,D

Expand?WordSave?LengthUsagePointsType
psychoanalyzed14
37 verb, adjectivev, adj
verb

• subject to psychoanalytic treatment

hypercivilized14
37 adjectiveadj
Valid word for Scrabble US
demythologized14
34 verb, adjectivev, adj
adjective satellite

• having mythical elements removed

hyperpolarized14
34 adjectiveadj
Valid word for Scrabble US
cycloheximides14
34 nounn
Valid word for Scrabble US
remythologized14
33 verb, adjectivev, adj
Valid word for Scrabble US
hydroxylamines14
33 nounn
Valid word for Scrabble US
demythologizes14
33 verbv
verb

• remove the mythical element from (writings)

demythologizer14
33 nounn
Valid word for Scrabble US
hydroxyproline14
33 nounn
noun

• a crystalline amino acid obtained from gelatin or collagen

or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 14 Letter Words

Words (246)
wholeheartedlyschoolchildrenindecipherablebullheadednessunaccomplishednorthumberlandphosphorylatedorthopedicallymethodologicaldemythologisedundecipherableoutlandishnessmethodicalnessdemythologizedcomprehendibleunderclothingstheatricalizedstoutheartedlysnaggletoothedremythologizedrehospitalizedpsychoanalyzedprepsychedelicphotoduplicatenonhalogenatedmultichamberedmethodologistslightheartedlyleukodystrophylandownershipsimmethodicallyhypercivilizedhydrobiologieshedonisticallyheavyheartedlygreatheartedlygeohydrologistdiphenylaminesdevilishnessesdelightfulnessantidiarrhealsthiabendazolestetrachloridesstadtholderatesledgehammeredshortsightedlypreestablishedphiladelphusesphencyclidinesoverlengthenedorthogonalizednonestablishedmuddleheadedlylongheadednesshypodiploidieshypodermicallyhyperpolarizedhydroxylamineshydrothermallyhydrochlorideshydrocephalieshydrocephalicshyaluronidasesheteroploidiesheteroduplexesheedlessnessesheartrendinglyheadlessnessesglutaraldehydegeohydrologiesflannelmouthedfaintheartedlyepithelializedendotheliomataencephalitidesdisestablishesdisestablisheddisenthrallingdinitrophenolsdichloroethanedemythologizesdemythologizerdechlorinationdechlorinatingcycloheximidescyanoethylatedcloddishnesseschlorpropamidechlamydosporeschildishnessescephaloridinescandlelightersbutyraldehydesradiotelephonyradiotelephoneradiotelegraphpolysaccharidehyperlipidemiahydroxyprolineglyceraldehydedolichocephalydermatoglyphicchlorothiazidevideotelephoneundiminishabletrisoctahedralthunderflashestheatricalisedtechnicolouredsulphanilamidesulphadiazinessulphacetamidestadholdershipstadholderatesspheroidicallyslipshodnessesslipshoddinessshillyshalliedsesquisulphidescratchbuilderschoolmasteredscalenohedronsrumbledethumpsrheumatoidallyremythologisedrehospitalisedpteridophilistpsychoanalysedphotoelectrodephlogisticatedphenomenalizedphenomenalisedoverflourishedorthogonalisedornithodelphicneanderthaloidneanderthalersmultithreadinglymphoadenomaslymphangitidesleucitohedronslecythidaceouslampadephoriaskinetheodoliteindecipherablyhyperpolarisedhyperdactylieshypercivilisedhydrosulphiteshydrosulphideshydrosulphateshydrokineticalhydrogeologisthydrogeologieshydrogenolysishydrogenolyseshydrocorallinehydrocephaloushydrocephaloidhydrocellulosehobbledehoyismhobbledehoyishhobbledehoydomhexactinellidshereditabilityhemispheroidalhallowednesseshalfwittednesshaemodialyzershaemodialysersgoodfellowshipgoldsmitheriesgentlemanhoodsgaleopithecoidflashforwardedepithelialisedendophyticallyedriophthalmicdysmenorrhoealdolichocephalsdisplenishmentdishabilitatesdishabilitateddisfellowshipsdisenthralmentdisembellishesdisembellisheddiphenylketonedimethylaminesdiaheliotropicdesulphurizingdesulphurizersdesulphurisingdesulphurisersdesulphurationdesulphuratingdephlegmationsdemythologisesdemythologiserdaughterlinessdactylographerchlorobromideschlorhexidinesbloodthirstierandrocephalousaerohydroplanewinding-clothesundecipherablyumbrella-shapedtechnical-gradetachyglossidaestraight-leggedstraight-billedspindle-shankedsingle-handedlyscyliorhinidaeplethodontidaepinwheel-shapedphyllostomidaepeachy-colouredogcocephalidaeneanderthalianmycetophilidaemichaelmastidemegalonychidaelight-heartedlyleft-handednesshypoadrenalismhigh-principledhelodermatidaehamamelidaceaehaloragidaceaefurfuraldehydefootball-shapeddermochelyidaedelphinapterusdehydroretinolcynocephalidaechlorthalidonechamaeleonidaecercidiphyllumcaryophyllidaecallithricidaebranchiobdellablabbermouthedbethlehem-judah
Phrases (244)
white blood cellvalet de chambreturkish delightthornton wilderthird ventriclesilver chlorideshoulder girdleshort-toed eaglescipio the elderschool-age childrough-and-tumblerhode island redphylum annelidaorder rhamnalesorder phallalesoracle of delphioff-the-shouldernoachian delugemortgage holderlobe-finned fishjoan sutherlandhotel detectivehordeum vulgarehonore de balzacholding patternhigh-heeled shoehendrik lorentzhans adolf krebshandling chargegenus helodermagenus didelphisgenus delphinusfour-wheel driveflightless birdfille de chambrefielder's choicefamily bothidaeepithelial ducteclectic methoddimethyl ketonedeciduous hollydante alighieridanish languagechordate familycharles dickensblended whiskeyball nightshadearound-the-clockyellow hawkweedyellow asphodelwilliam h. sewardwilhelm ostwaldwild-goose chasewild cherry treewhorled carawaywhole meal breadwheeled vehiclewalker foxhoundtracked vehiclethreshold levelthree-toed sloththickly settledthe netherlandstetraethyl leadtelephone ordersulphur dioxidesteroid alcoholstarting handlestar of the veldtspotted hemlockspanish needlessoft shield fernsodium sulphatesodium chloridesodium chloratesix-gilled sharksir john gielgudsindhi languageshowy goldenrodshouldered archshepherd's clocksedum telephiumscotch asphodelrochelle powderrichardson volerichard smalleyrichard nevillerichard haldanerhythm and bluesrhomboid musclerepublic of chadreindeer lichenred helleborinequeensland hempposthole diggerpost-hole diggerpicnic shoulderpickled herringphylum nematodaphilip andersonperchloric acidpackage holidayorder pholidotaold north frenchnuclear warheadnodding thistlenight blindnessneanderthal manmichael faradaymelia azederachmelia azedarachmedicinal leechmedical historymedical checkuplymphoid tissuelying under oathlord chancellorlightly armoredlettre de cachetleonid brezhnevlead tetraethylldl cholesterollaurel and hardylath and plasterlady-of-the-nightlady of the housekuchean dialectkalahari desertjude the apostlejewish calendarindian elephanthydraulic presshydraulic brakehurler's diseasehuddle togetherhousehold linenhotel desk clerkholly-leaved oakhoek van hollandhimalayan cedarhigh-speed steelherbal medicinehepatitis deltahebridean isleshebrew calendarheaviside layerhdl cholesterolhatteras islandharold harefoothandheld vacuumhand-held vacuumhalogeton soudahair-tailed molegreenland whalegreat horned owlgraduate schoolgolden pholiotagolden pheasantgive the glad eyegenus plethodongenus pholidotagenus chlamydiagaff-headed sailfully fashionedfrench marigoldfrench lavenderfor all the worldfluid mechanicsflemish dialectfield horsetailfield chickweedfield chamomilefiddlehead fernfeudal lordshipfast of gedaliahfamily raphidaefamily physidaefamily pholidaefamily phocidaeethmoidal sinusestradiol patchepicanthic foldenglish bulldogelymus hispiduselijah muhammadelderberry bushedward the elderearly childhooddyers' chamomiledutch-elm beetledutch elm fungusduc de richelieudress rehearsaldouglas hemlockdorothy l. sayersdomestic flightdolphin strikerdogtooth violetdithered colourdevil worshiperdelta hepatitisdelichon urbicadaphne laureolacrushed leathercosimo the eldercolored hearingclose to the windclaude e. shannonclass hirudineaclass channidaechurch calendarchorale preludechocolate fudgechocolate candychloride of limechloral hydratechinese wood oilchills and feverchickweed phloxcharles the baldcharles dodgsonchadic languagecash on deliverycanadian shieldcalendar methodcalcium hydridecalcium hydratebreech deliveryblessed thistleblack horehoundblack hollanderbernard hinaultberlin doughnutbelted sandfishbeaked hazelnutbeach goldenrodash-leaved maplearmored vehiclealfred the greatalder buckthornair-raid shelteracyl anhydridesachilles tendonacetyl chloride
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen