Select a search method
Start letters
End letters
Use underscore '_' for wildcard/blank. Comma ',' for any order.eg. 'CAN' matches Cane, Scan | 'C,A,N' matches Acne
    Dictionary Only:
    Profanity Off:

    14-Letter Words Containing: H,D,L

     (In Any Order)
    There are 293 14 letter words, 296 14 letter phrases and 0 14 letter abbr's with H,D,L in.
    Did you mean?
    All 14 letter words14 Letter words with HDL (in order)All words with H,D,LAnagrams of HDL

    Best Scoring 14 Letter Words With: H,D,L

    Expand?WordSave?LengthUsagePointsType
    psychoanalyzed14
    		37 verb, adjectivev, adj
    verb

    • subject to psychoanalytic treatment

    hypercivilized14
    		37 adjectiveadj
    Valid word for Scrabble US
    demythologized14
    		34 verb, adjectivev, adj
    adjective satellite

    • having mythical elements removed

    hyperpolarized14
    		34 adjectiveadj
    Valid word for Scrabble US
    cycloheximides14
    		34 nounn
    Valid word for Scrabble US
    remythologized14
    		33 verb, adjectivev, adj
    Valid word for Scrabble US
    hydroxylamines14
    		33 nounn
    Valid word for Scrabble US
    demythologizes14
    		33 verbv
    verb

    • remove the mythical element from (writings)

    demythologizer14
    		33 nounn
    Valid word for Scrabble US
    hydroxyproline14
    		33 nounn
    noun

    • a crystalline amino acid obtained from gelatin or collagen

    or scroll down to see all results...
    Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

    All 14 Letter Words

    Words (293)
    wholeheartedlyschoolchildrenindecipherablebullheadednessunaccomplishednorthumberlandphosphorylatedorthopedicallymethodologicaldemythologisedbronchodilatorundecipherableoutlandishnessmethodicalnessdemythologizedcomprehendibleunderclothingsultrahazardoustheatricalizedstoutheartedlysnaggletoothedremythologizedrehospitalizedpsychoanalyzedprepsychedelicphotoduplicatephilanthropoidnonhalogenatedmultichamberedmethodologistslightheartedlyleukodystrophylandownershipsimmethodicallyhypercivilizedhydrodynamicalhydrocolloidalhydrobiologisthydrobiologieshedonisticallyheavyheartedlygreatheartedlygeohydrologistdiphenylaminesdevilishnessesdelightfulnessantidiarrhealsthiabendazolestetrachloridessubarachnoidalstadtholderatesledgehammeredshortsightedlyquadrillionthspreestablishedphiladelphusesphencyclidinesoverlengthenedorthogonalizednonestablishedmuddleheadedlylongheadednessidiopathicallyhypodiploidieshypodermicallyhyperpolarizedhydroxylationshydroxylamineshydrothermallyhydroponicallyhydrophilicityhydrolyticallyhydrologicallyhydrochlorideshydrocephalieshydrocephalicshyaluronidasesheteroploidiesheteroduplexesheedlessnessesheartrendinglyheadlessnessesglutaraldehydegeohydrologiesflannelmouthedfaintheartedlyepithelializedendotheliomataencephalitidesdisestablishesdisestablisheddisenthrallingdiscographicaldinitrophenolsdichloroethanediachronicallydemythologizesdemythologizerdechlorinationdechlorinatingcycloheximidescyanoethylatedcloddishnessesclavichordistschlorpropamidechlamydosporeschildishnessescephaloridinescandlelightersbutyraldehydesbloodthirstilyradiotelephonyradiotelephoneradiotelegraphpolysaccharidelabyrinthodonthyperlipidemiahydroxyprolineglyceraldehydedolichocephalydermatoglyphicchlorothiazideachondroplasiavideotelephoneundiminishabletrisoctahedralthunderflashestheatricalisedtechnicolouredsulphanilamidesulphadiazinessulphacetamidestadholdershipstadholderatesspheroidicallyslipshodnessesslipshoddinessshillyshalliedsesquisulphidescratchbuilderschoolmasteredscalenohedronsrumbledethumpsrheumatoidallyremythologisedrehospitalisedpteridophilistpsychoanalysedpodophthalmousphotoelectrodephlogisticatedphenomenalizedphenomenalisedpachydactylousoverflourishedorthogonalisedorthodiagonalsornithodelphicorchidologistsneanderthaloidneanderthalersmultithreadinglymphoadenomaslymphangitidesleucitohedronslecythidaceouslampadephoriaskinetheodoliteindecipherablyhypomixolydianhyperpolarisedhyperdactylieshypercivilisedhydrosulphurichydrosulphiteshydrosulphideshydrosulphateshydrolyzationshydrolysationshydrokineticalhydrogeologisthydrogeologieshydrogenolysishydrogenolyseshydrocorallinehydrocephaloushydrocephaloidhydrocellulosehobbledehoyismhobbledehoyishhobbledehoydomhexactinellidshereditabilityhemispheroidalhallowednesseshalfwittednesshaemodialyzershaemodialysersgoodfellowshipgoldsmitheriesgladiatorshipsgentlemanhoodsgaleopithecoidfloodlightingsflashforwardedepithelialisedendophyticallyedriophthalmicdysmenorrhoealdolichocephalsdisplenishmentdisinthrallingdishabilitatesdishabilitateddisfellowshipsdisenthralmentdisembellishesdisembellisheddiphenylketonedimethylaminesdiaheliotropicdiacatholiconsdesulphurizingdesulphurizersdesulphurisingdesulphurisersdesulphurationdesulphuratingdephlegmationsdemythologisesdemythologiserdaughterlinessdactylographicdactylographerdactyliographycoachbuildingschlorophylloidchlorobromideschlorhexidinesbrachydiagonalbloodthirstierandrocephalousaerohydroplanewinding-clothesundecipherablyumbrella-shapedtechnical-gradetachyglossidaestraight-leggedstraight-billedspindle-shankedsingle-handedlyshallow-draughtscyliorhinidaeplethodontidaeplasmodiophorapinwheel-shapedphyllostomidaepeachy-colouredogcocephalidaeneanderthalianmycetophilidaemulloidichthysmichaelmastidemegalonychidaelight-heartedlyleft-handednesshypoadrenalismhydrographicalhigh-principledhelodermatidaehaplosporidianhamamelidaceaehaloragidaceaefurfuraldehydefootball-shapeddolichocranialdermochelyidaedelphinapterusdehydroretinolcynocephalidaechlorthalidonechlamydosauruschamaeleonidaecercidiphyllumcaryophyllidaecallithricidaebranchiobdellabrachydactylicbrachydactyliablabbermouthedbethlehem-judahachondroplasty
    Phrases (296)
    xiphias gladiuswild bill hickokwhite blood cellvalet de chambreturkish delightthornton wilderthird ventriclesilver chlorideshoulder girdleshort-toed eagleshallow fordingscipio the elderschool-age childrough-and-tumblerhode island redphylum chordataphylum annelidaorder rhamnalesorder phallalesoracle of delphioff-the-shouldernoachian delugemortgage holdermalpighian bodylobe-finned fishlachrymal glandjoan sutherlandirish wolfhoundhotel detectivehordeum vulgarehonore de balzachong kong dollarholding patternholding paddockhigh-heeled shoehendrik lorentzhans adolf krebshandling chargegenus helodermagenus didelphisgenus delphinusfour-wheel driveflightless birdfille de chambrefielder's choicefamily bothidaeepithelial ducteclectic methoddrug withdrawaldimethyl ketonedeciduous hollydante alighieridanish languageclass arachnidachordate familycharles dickenscapital of idahobusman's holidayblended whiskeybank withdrawalball nightshadearound-the-clockalcoholic drinkyellow hawkweedyellow asphodelwithholding taxwilliam h. sewardwilhelm ostwaldwild-goose chasewild cherry treewhorled carawaywhole meal breadwhiptail lizardwheeled vehiclewalker foxhoundtracked vehiclethreshold levelthree-toed sloththird-class mailthickly settledthe netherlandstetraethyl leadtelephone ordersulphur dioxidesteroid alcoholstarting handlestar of the veldtspotted hemlockspanish needlessoft shield fernsodium sulphatesodium chloridesodium chloratesix-gilled sharksir john gielgudsir alan hodgkinsindhi languageshowy goldenrodshouldered archshepherd's clocksedum telephiumscotch marigoldscotch asphodelschool districtrochelle powderrichardson volerichard smalleyrichard nevillerichard haldanerhythm and bluesrhomboid musclerepublic of chadreindeer lichenred helleborinequeensland hempposthole diggerpost-hole diggerpicnic shoulderpickled herringphylum nematodaphylum cnidariaphilip andersonperchloric acidpackage holidayout of this worldorder pholidotaold north frenchnuclear warheadnodding thistlenight blindnessneanderthal mannabothian glandmoloch horridusmichael faradaymelia azederachmelia azedarachmedicinal leechmedical historymedical checkuplyndon b. johnsonlymphoid tissuelying under oathlord chancellorlightly armoredlettre de cachetleonid brezhnevlead tetraethylldl cholesterollaurel and hardylath and plasterlady-of-the-nightlady of the housekuchean dialectkalahari desertjudicial branchjude the apostlejewish calendarindian elephanthydrazo radicalhydraulic presshydraulic motorhydraulic brakehydnocarpus oilhyaluronic acidhurler's diseasehudson hoaglandhuddle togetherhousehold linenhotel desk clerkholly-leaved oakholding companyhoek van hollandhimalayan cedarhigh-speed steelherbal medicinehepatitis deltahebridean isleshebrew calendarheaviside layerhdl cholesterolhatteras islandhasdrubal barcaharold nicolsonharold harefoothandheld vacuumhand-held vacuumhand calculatorhalogeton soudahair-tailed molegulf of thailandgreenland whalegreat horned owlgraduate schoolgolden pholiotagolden pheasantgive the glad eyegenus plethodongenus pholidotagenus chlamydiagaff-headed sailfully fashionedfrench marigoldfrench lavenderfor all the worldflying dutchmanfluid mechanicsflemish dialectfield horsetailfield chickweedfield chamomilefiddlehead fernfeudal lordshipfast of gedaliahfamily raphidaefamily physidaefamily pholidaefamily phocidaeethmoidal sinusestradiol patchepicanthic foldenglish bulldogelymus hispiduselijah muhammadelderberry bushedward the elderearly childhooddyers' chamomiledutch-elm beetledutch elm fungusduc de richelieudress rehearsaldouglas hemlockdorothy l. sayersdomestic flightdolphin strikerdolichos lablabdogtooth violetdithered colourdishcloth gourddevil worshiperdelta hepatitisdelichon urbicadaylight visiondaylight savingdaphne laureolacrushed leathercosimo the eldercolored hearingclose to the windclaude e. shannonclass phasmidiaclass hirudineaclass chilopodaclass channidaechurchill downschurch calendarchurch buildingchorale preludechocolate fudgechocolate candychloride of limechloral hydratechinese wood oilchills and feverchickweed phloxcharles the baldcharles dodgsonchadic languagecash on deliverycanadian shieldcalendar methodcalcium hydridecalcium hydratebreech deliveryboarding schoolblind stitchingblessed thistleblack horehoundblack hollanderbig bill haywoodbernard hinaultberlin doughnutbelted sandfishbeaked hazelnutbeach goldenrodbahamian dollarash-leaved maplearmored vehiclealpha radiationalfred the greatalder buckthornalcohol radicalair-raid shelteracyl anhydridesachilles tendonacetyl chloride
    WordDB Icon
    WordDB
    United Kingdom
    Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
    1.
    Tap on share button
    2.
    Tap on Add To Home Screenadd button
    3.
    Find WordDB App Icon on your home screen