14-Letter Words Containing: H,A,N,K,I,E,S
(In Any Order)
There are 16 14 letter words,
20 14 letter phrases and
0 14 letter abbr's with
H,A,N,K,I,E,S in.
Best Scoring 14 Letter Words With: H,A,N,K,I,E,S
Expand? | Word | Save? | Length | Usage | Points | Type | ||
---|---|---|---|---|---|---|---|---|
handkerchieves | 14 | 30 | nounn | |||||
noun • A piece of cloth, usually square and often fine and elegant, carried for wiping the face, eyes, nose or hands. • A piece of cloth shaped like a handkerchief to be worn about the neck; a neckerchief or neckcloth. | ||||||||
phosphokinases | 14 | 28 | nounn | |||||
Valid word for Scrabble US
| ||||||||
earthshakingly | 14 | 28 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
spokesmanships | 14 | 27 | nounn | |||||
Valid word for Scrabble US
| ||||||||
thrombokinases | 14 | 25 | nounn | |||||
noun • an enzyme liberated from blood platelets that converts prothrombin into thrombin as blood starts to clot | ||||||||
brackishnesses | 14 | 25 | nounn | |||||
noun • the quality of being salty, as the saltiness of water | ||||||||
housebreakings | 14 | 24 | nounn | |||||
noun • trespassing for an unlawful purpose; illegal entrance into premises with criminal intent | ||||||||
freakishnesses | 14 | 24 | nounn | |||||
noun • marked strangeness as a consequence of being abnormal | ||||||||
prankishnesses | 14 | 23 | nounn | |||||
noun • the trait of indulging in disreputable pranks | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
All 14 Letter Words
Words (16)
housebreakingsthrombokinasesspokesmanshipsprankishnessesphosphokinaseshandkerchievesfreakishnessesearthshakinglybrackishnessessneakishnesseskinesipathistskinematographsspindle-shankedmischief-makingharlequin-snakefrench-speakingPhrases (20)
stephen hawkingsir joseph bankschicken scratchcharles dickensandrei sakharovwhite snakerootshopping basketpitch blacknessmichael jacksonman-eating sharkkerosine heaterkenyan shillinghousemaid's kneeguy fawkes nightgenus kniphofiafisherman's knoteuropean shrikecoleman hawkinscoachwhip snakechinese cork oak