14-Letter Words Containing: E,K,I,S,S
(In Any Order)
There are 80 14 letter words,
50 14 letter phrases and
0 14 letter abbr's with
E,K,I,S,S in.
Best Scoring 14 Letter Words With: E,K,I,S,S
Expand? | Word | Save? | Length | Usage | Points | Type | ||
---|---|---|---|---|---|---|---|---|
phosphokinases | 14 | 28 | nounn | |||||
Valid word for Scrabble US
| ||||||||
omphaloskepsis | 14 | 27 | nounn | |||||
noun • literally, the contemplation of one's navel, which is an idiom usually meaning complacent self-absorption | ||||||||
spokesmanships | 14 | 27 | nounn | |||||
Valid word for Scrabble US
| ||||||||
hyperkeratosis | 14 | 26 | nounn | |||||
noun • Excess keratin formation on the skin surface, as can be seen in a number of dermatologic conditions. | ||||||||
thrombokinases | 14 | 25 | nounn | |||||
noun • an enzyme liberated from blood platelets that converts prothrombin into thrombin as blood starts to clot | ||||||||
homesicknesses | 14 | 25 | ||||||
noun • a longing to return home | ||||||||
brackishnesses | 14 | 25 | nounn | |||||
noun • the quality of being salty, as the saltiness of water | ||||||||
strikebreakers | 14 | 24 | nounn | |||||
noun • someone who works (or provides workers) during a strike | ||||||||
housebreakings | 14 | 24 | nounn | |||||
noun • trespassing for an unlawful purpose; illegal entrance into premises with criminal intent | ||||||||
heterokaryosis | 14 | 24 | nounn | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
All 14 Letter Words
Words (80)
unbusinesslikeomphaloskepsistaskmistressesstrikebreakersskullduggeriesskittishnessesskillfulnesseslifelikenesseskapellmeistershousebreakingsunlikelinessesunkindlinessestrickishnessesticklishnessesthunderstrikesthrombokinasesthinkingnessesstreptokinasesstreetwalkingsspokesmanshipsskillessnessesskateboardingssemidarknessesprankishnessesphosphokinaseslovesicknessesleukemogenesisknightlinesseskeratoplastieshyperkeratosishomesicknessesheterokaryosisfreakishnessescounterstrikesbrackishnessesunskillfulnessleukocytosisesworkmistressesunthinkingnessunknightlinessstrikingnessesstockjobberiesstockishnessesstockbreedingsstinkingnessesstickabilitiessnickersneeingsneakishnessessneakingnessesskeuomorphismsshockingnessesshockabilitiesquicksilverishpneumokoniosispneumokoniosespernicketinessoverkindnessesmountebankismsmistakennessesmarketisationslocksmitherieslikeablenessesladylikenesseskinesipathistskinesiologistskettlestitcheskakistocracieshousewifeskepsgallsicknessesdisembarkmentsconstablewicksblokeishnessesblockishnessesbarnsbreakingsalkalescenciesspindle-shankedsiouan-speakingschlockmeisterloving-kindnesscoxsackievirusPhrases (50)
swimming strokesurprise attacksouth yorkshiresmall livestocksleepy sicknesssir joseph banksmonkey businesskissing diseaseischemic strokehenry kissingerdrinking vesselcharles dickenswork in progresssyringa josikeasympathy strikesurgical strikestokesia laevissticks and stonespeak in tonguesskeleton shrimpsix-gilled sharkshopping basketsalisbury steakrisk of exposurepitch blacknesspigs in blanketsmotion sicknessmolasses cookiemilky way systemmeasuring stickmarket analysislake trasimenusknight's servicekissimmee riverkegel exercisesjengish chokusujames parkinsonjackass penguinhousemaid's kneegenus strekeliagenus peireskiagenus jacksoniagenus dicksoniagenus amsinckiafisherman's knotcoxsackie virusclassical greekcassia-bark treeboris pasternakberkshire hills