Dictionary Only:
Profanity Off:

14-Letter Words Containing: D,H,I,L

 (In Any Order)
There are 233 14 letter words, 203 14 letter phrases and 0 14 letter abbr's with D,H,I,L in.

Best Scoring 14 Letter Words With: D,H,I,L

Expand?WordSave?LengthUsagePointsType
hypercivilized14
37 adjectiveadj
Valid word for Scrabble US
demythologized14
34 verb, adjectivev, adj
adjective satellite

• having mythical elements removed

hyperpolarized14
34 adjectiveadj
Valid word for Scrabble US
cycloheximides14
34 nounn
Valid word for Scrabble US
remythologized14
33 verb, adjectivev, adj
Valid word for Scrabble US
hydroxylamines14
33 nounn
Valid word for Scrabble US
demythologizes14
33 verbv
verb

• remove the mythical element from (writings)

demythologizer14
33 nounn
Valid word for Scrabble US
hydroxyproline14
33 nounn
noun

• a crystalline amino acid obtained from gelatin or collagen

chlorothiazide14
32 nounn
noun

• a diuretic drug (trade name Diuril) used in the treatment of edema and hypertension

or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 14 Letter Words

Words (233)
schoolchildrenindecipherableunaccomplishedorthopedicallymethodologicaldemythologisedbronchodilatorundecipherableoutlandishnessmethodicalnessdemythologizedcomprehendibleunderclothingstheatricalizedremythologizedrehospitalizedprepsychedelicphotoduplicatephilanthropoidmultichamberedmethodologistslightheartedlylandownershipsimmethodicallyhypercivilizedhydrodynamicalhydrocolloidalhydrobiologisthydrobiologieshedonisticallygeohydrologistdiphenylaminesdevilishnessesdelightfulnessantidiarrhealsthiabendazolestetrachloridessubarachnoidalshortsightedlyquadrillionthspreestablishedphiladelphusesphencyclidinesorthogonalizednonestablishedidiopathicallyhypodiploidieshypodermicallyhyperpolarizedhydroxylationshydroxylamineshydroponicallyhydrophilicityhydrolyticallyhydrologicallyhydrochlorideshydrocephalieshydrocephalicshyaluronidasesheteroploidiesheartrendinglygeohydrologiesfaintheartedlyepithelializedendotheliomataencephalitidesdisestablishesdisestablisheddisenthrallingdiscographicaldinitrophenolsdichloroethanediachronicallydemythologizesdemythologizerdechlorinationdechlorinatingcycloheximidescloddishnessesclavichordistschlorpropamidechildishnessescephaloridinescandlelightersbloodthirstilyradiotelephonyradiotelephoneradiotelegraphpolysaccharidelabyrinthodonthyperlipidemiahydroxyprolinedolichocephalydermatoglyphicchlorothiazideachondroplasiavideotelephoneundiminishabletrisoctahedraltheatricalisedtechnicolouredsulphanilamidesulphadiazinessulphacetamidestadholdershipspheroidicallyslipshodnessesslipshoddinessshillyshalliedsesquisulphidescratchbuilderrheumatoidallyremythologisedrehospitalisedpteridophilistphlogisticatedphenomenalizedphenomenalisedoverflourishedorthogonalisedorthodiagonalsornithodelphicorchidologistsneanderthaloidmultithreadinglymphangitidesleucitohedronslecythidaceouslampadephoriaskinetheodoliteindecipherablyhypomixolydianhyperpolarisedhyperdactylieshypercivilisedhydrosulphurichydrosulphiteshydrosulphideshydrolyzationshydrolysationshydrokineticalhydrogeologisthydrogeologieshydrogenolysishydrocorallinehydrocephaloidhobbledehoyismhobbledehoyishhexactinellidshereditabilityhemispheroidalhalfwittednesshaemodialyzershaemodialysersgoodfellowshipgoldsmitheriesgladiatorshipsgaleopithecoidfloodlightingsepithelialisedendophyticallyedriophthalmicdolichocephalsdisplenishmentdisinthrallingdishabilitatesdishabilitateddisfellowshipsdisenthralmentdisembellishesdisembellisheddiphenylketonedimethylaminesdiaheliotropicdiacatholiconsdesulphurizingdesulphurizersdesulphurisingdesulphurisersdesulphurationdesulphuratingdephlegmationsdemythologisesdemythologiserdaughterlinessdactylographicdactyliographycoachbuildingschlorophylloidchlorobromideschlorhexidinesbrachydiagonalbloodthirstierwinding-clothesundecipherablytechnical-gradetachyglossidaestraight-leggedstraight-billedspindle-shankedsingle-handedlyscyliorhinidaeplethodontidaeplasmodiophorapinwheel-shapedphyllostomidaeogcocephalidaeneanderthalianmycetophilidaemulloidichthysmichaelmastidemegalonychidaelight-heartedlyhypoadrenalismhydrographicalhigh-principledhelodermatidaehaplosporidianhamamelidaceaehaloragidaceaedolichocranialdermochelyidaedelphinapterusdehydroretinolcynocephalidaechlorthalidonechamaeleonidaecercidiphyllumcaryophyllidaecallithricidaebranchiobdellabrachydactylicbrachydactylia
Phrases (203)
xiphias gladiuswild bill hickokwhite blood cellturkish delightthornton wilderthird ventriclesilver chlorideshoulder girdleshallow fordingscipio the elderschool-age childrhode island redphylum annelidaoracle of delphinoachian delugemalpighian bodylobe-finned fishirish wolfhoundhotel detectiveholding patternholding paddockhigh-heeled shoehendrik lorentzhandling chargegenus didelphisgenus delphinusfour-wheel driveflightless birdfille de chambrefielder's choicefamily bothidaeepithelial ducteclectic methoddrug withdrawaldimethyl ketonedeciduous hollydante alighieridanish languageclass arachnidachordate familycharles dickenscapital of idahobusman's holidayblended whiskeybank withdrawalball nightshadealcoholic drinkwithholding taxwilliam h. sewardwilhelm ostwaldwild-goose chasewild cherry treewhiptail lizardwheeled vehicletracked vehiclethird-class mailthickly settledsulphur dioxidesteroid alcoholstarting handlespanish needlessoft shield fernsodium sulphatesodium chloridesodium chloratesix-gilled sharksir john gielgudsir alan hodgkinsindhi languagesedum telephiumscotch marigoldschool districtrichardson volerichard smalleyrichard nevillerichard haldanerhomboid musclerepublic of chadreindeer lichenred helleborineposthole diggerpost-hole diggerpicnic shoulderpickled herringphylum cnidariaphilip andersonperchloric acidpackage holidayout of this worldorder pholidotanodding thistlenight blindnessnabothian glandmoloch horridusmichael faradaymelia azederachmelia azedarachmedicinal leechmedical historymedical checkuplymphoid tissuelying under oathlightly armoredleonid brezhnevlady-of-the-nightkuchean dialectkalahari desertjudicial branchjewish calendarindian elephanthydrazo radicalhydraulic presshydraulic motorhydraulic brakehydnocarpus oilhyaluronic acidhurler's diseasehousehold linenholding companyhimalayan cedarhigh-speed steelherbal medicinehepatitis deltahebridean islesheaviside layerhatteras islandharold nicolsonhair-tailed molegulf of thailandgolden pholiotagive the glad eyegenus pholidotagenus chlamydiagaff-headed sailfully fashionedfrench marigoldflying dutchmanfluid mechanicsflemish dialectfield horsetailfield chickweedfield chamomilefiddlehead fernfeudal lordshipfast of gedaliahfamily raphidaefamily physidaefamily pholidaefamily phocidaeethmoidal sinusestradiol patchepicanthic foldenglish bulldogelymus hispiduselijah muhammadearly childhooddyers' chamomileduc de richelieudomestic flightdolphin strikerdolichos lablabdogtooth violetdithered colourdishcloth gourddevil worshiperdelta hepatitisdelichon urbicadaylight visiondaylight savingcosimo the eldercolored hearingclose to the windclass phasmidiaclass hirudineaclass chilopodaclass channidaechurchill downschurch buildingchloride of limechinese wood oilchills and feverchickweed phloxchadic languagecash on deliverycanadian shieldcalcium hydridecalcium hydratebreech deliveryboarding schoolblind stitchingblessed thistlebig bill haywoodbernard hinaultberlin doughnutbelted sandfishbahamian dollararmored vehiclealpha radiationalcohol radicalair-raid shelteracyl anhydridesachilles tendonacetyl chloride
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen