Dictionary Only:
Profanity Off:

14-Letter Words Containing: D,E,H,I,L

 (In Any Order)
There are 192 14 letter words, 158 14 letter phrases and 0 14 letter abbr's with D,E,H,I,L in.

Best Scoring 14 Letter Words With: D,E,H,I,L

Expand?WordSave?LengthUsagePointsType
hypercivilized14
37 adjectiveadj
Valid word for Scrabble US
demythologized14
34 verb, adjectivev, adj
adjective satellite

• having mythical elements removed

hyperpolarized14
34 adjectiveadj
Valid word for Scrabble US
cycloheximides14
34 nounn
Valid word for Scrabble US
remythologized14
33 verb, adjectivev, adj
Valid word for Scrabble US
hydroxylamines14
33 nounn
Valid word for Scrabble US
demythologizes14
33 verbv
verb

• remove the mythical element from (writings)

demythologizer14
33 nounn
Valid word for Scrabble US
hydroxyproline14
33 nounn
noun

• a crystalline amino acid obtained from gelatin or collagen

chlorothiazide14
32 nounn
noun

• a diuretic drug (trade name Diuril) used in the treatment of edema and hypertension

or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 14 Letter Words

Words (192)
schoolchildrenindecipherableunaccomplishedorthopedicallymethodologicaldemythologisedundecipherableoutlandishnessmethodicalnessdemythologizedcomprehendibleunderclothingstheatricalizedremythologizedrehospitalizedprepsychedelicphotoduplicatemultichamberedmethodologistslightheartedlylandownershipsimmethodicallyhypercivilizedhydrobiologieshedonisticallygeohydrologistdiphenylaminesdevilishnessesdelightfulnessantidiarrhealsthiabendazolestetrachloridesshortsightedlypreestablishedphiladelphusesphencyclidinesorthogonalizednonestablishedhypodiploidieshypodermicallyhyperpolarizedhydroxylamineshydrochlorideshydrocephalieshydrocephalicshyaluronidasesheteroploidiesheartrendinglygeohydrologiesfaintheartedlyepithelializedendotheliomataencephalitidesdisestablishesdisestablisheddisenthrallingdinitrophenolsdichloroethanedemythologizesdemythologizerdechlorinationdechlorinatingcycloheximidescloddishnesseschlorpropamidechildishnessescephaloridinescandlelightersradiotelephonyradiotelephoneradiotelegraphpolysaccharidehyperlipidemiahydroxyprolinedolichocephalydermatoglyphicchlorothiazidevideotelephoneundiminishabletrisoctahedraltheatricalisedtechnicolouredsulphanilamidesulphadiazinessulphacetamidestadholdershipspheroidicallyslipshodnessesslipshoddinessshillyshalliedsesquisulphidescratchbuilderrheumatoidallyremythologisedrehospitalisedpteridophilistphlogisticatedphenomenalizedphenomenalisedoverflourishedorthogonalisedornithodelphicneanderthaloidmultithreadinglymphangitidesleucitohedronslecythidaceouslampadephoriaskinetheodoliteindecipherablyhyperpolarisedhyperdactylieshypercivilisedhydrosulphiteshydrosulphideshydrokineticalhydrogeologisthydrogeologieshydrogenolysishydrocorallinehydrocephaloidhobbledehoyismhobbledehoyishhexactinellidshereditabilityhemispheroidalhalfwittednesshaemodialyzershaemodialysersgoodfellowshipgoldsmitheriesgaleopithecoidepithelialisedendophyticallyedriophthalmicdolichocephalsdisplenishmentdishabilitatesdishabilitateddisfellowshipsdisenthralmentdisembellishesdisembellisheddiphenylketonedimethylaminesdiaheliotropicdesulphurizingdesulphurizersdesulphurisingdesulphurisersdesulphurationdesulphuratingdephlegmationsdemythologisesdemythologiserdaughterlinesschlorobromideschlorhexidinesbloodthirstierwinding-clothesundecipherablytechnical-gradetachyglossidaestraight-leggedstraight-billedspindle-shankedsingle-handedlyscyliorhinidaeplethodontidaepinwheel-shapedphyllostomidaeogcocephalidaeneanderthalianmycetophilidaemichaelmastidemegalonychidaelight-heartedlyhypoadrenalismhigh-principledhelodermatidaehamamelidaceaehaloragidaceaedermochelyidaedelphinapterusdehydroretinolcynocephalidaechlorthalidonechamaeleonidaecercidiphyllumcaryophyllidaecallithricidaebranchiobdella
Phrases (158)
white blood cellturkish delightthornton wilderthird ventriclesilver chlorideshoulder girdlescipio the elderschool-age childrhode island redphylum annelidaoracle of delphinoachian delugelobe-finned fishhotel detectiveholding patternhigh-heeled shoehendrik lorentzhandling chargegenus didelphisgenus delphinusfour-wheel driveflightless birdfille de chambrefielder's choicefamily bothidaeepithelial ducteclectic methoddimethyl ketonedeciduous hollydante alighieridanish languagechordate familycharles dickensblended whiskeyball nightshadewilliam h. sewardwilhelm ostwaldwild-goose chasewild cherry treewheeled vehicletracked vehiclethickly settledsulphur dioxidesteroid alcoholstarting handlespanish needlessoft shield fernsodium sulphatesodium chloridesodium chloratesix-gilled sharksir john gielgudsindhi languagesedum telephiumrichardson volerichard smalleyrichard nevillerichard haldanerhomboid musclerepublic of chadreindeer lichenred helleborineposthole diggerpost-hole diggerpicnic shoulderpickled herringphilip andersonperchloric acidpackage holidayorder pholidotanodding thistlenight blindnessmichael faradaymelia azederachmelia azedarachmedicinal leechmedical historymedical checkuplymphoid tissuelying under oathlightly armoredleonid brezhnevlady-of-the-nightkuchean dialectkalahari desertjewish calendarindian elephanthydraulic presshydraulic brakehurler's diseasehousehold linenhimalayan cedarhigh-speed steelherbal medicinehepatitis deltahebridean islesheaviside layerhatteras islandhair-tailed molegolden pholiotagive the glad eyegenus pholidotagenus chlamydiagaff-headed sailfully fashionedfrench marigoldfluid mechanicsflemish dialectfield horsetailfield chickweedfield chamomilefiddlehead fernfeudal lordshipfast of gedaliahfamily raphidaefamily physidaefamily pholidaefamily phocidaeethmoidal sinusestradiol patchepicanthic foldenglish bulldogelymus hispiduselijah muhammadearly childhooddyers' chamomileduc de richelieudomestic flightdolphin strikerdogtooth violetdithered colourdevil worshiperdelta hepatitisdelichon urbicacosimo the eldercolored hearingclose to the windclass hirudineaclass channidaechloride of limechinese wood oilchills and feverchickweed phloxchadic languagecash on deliverycanadian shieldcalcium hydridecalcium hydratebreech deliveryblessed thistlebernard hinaultberlin doughnutbelted sandfisharmored vehicleair-raid shelteracyl anhydridesachilles tendonacetyl chloride
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen