14-Letter Words Containing: A,E,E,L,N,P,S,Y
(In Any Order)
There are 25 14 letter words,
13 14 letter phrases and
0 14 letter abbr's with
A,E,E,L,N,P,S,Y in.
Best Scoring
Expand? | Word | Save? | Length | Usage | Points | Type | ||
---|---|---|---|---|---|---|---|---|
exasperatingly | 14 | 27 | adverb, adjectiveadv, adj | |||||
adverb • in an exasperating manner | ||||||||
apprehensively | 14 | 27 | adverb, adjectiveadv, adj | |||||
adverb • with anxiety or apprehension | ||||||||
hypermasculine | 14 | 26 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
diphenylamines | 14 | 25 | nounn | |||||
Valid word for Scrabble US
| ||||||||
physicalnesses | 14 | 24 | ||||||
noun • the quality of being physical; consisting of matter | ||||||||
encyclopaedias | 14 | 24 | nounn | |||||
noun • a reference work (often in several volumes) containing articles on various topics (often arranged in alphabetical order) dealing with the entire range of human knowledge or with some particular specialty | ||||||||
polybutadienes | 14 | 22 | nounn | |||||
Valid word for Scrabble US
| ||||||||
phenylalanines | 14 | 22 | nounn | |||||
noun • an essential amino acid found in proteins and needed for growth of children and for protein metabolism in children and adults; abundant in milk and eggs; it is normally converted to tyrosine in the human body | ||||||||
presentability | 14 | 21 | nounn | |||||
Valid word for Scrabble US
| ||||||||
premenstrually | 14 | 21 | verb, adverb, adjectivev, adv, adj | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
All 14 Letter Words
Words (25)
presentabilitypolybutadieneshypermasculinediphenylaminesexasperatinglypremenstruallyphysicalnessesphenylalaninespestilentiallypercutaneouslyencyclopaediascounterplayerspresidentiallyapprehensivelysupplementallypsephoanalysesprecessionallyprayerlessnesspentadactyliesmaldeploymentsdispensativelyshove-halfpennymeanspiritedlyencyclopaedistencyclopaedismPhrases (13)
personal memorychinese parsleysleeping beautysapele mahoganypolygala senegaplanetary housenew people's armymickey spillaneherpestes nyulagenus stypheliagenus staphyleagenus phillyreafalse pregnancy