13-Letter Words Containing: E,R,P,E,A,K
(In Any Order)
There are 18 13 letter words,
43 13 letter phrases and
0 13 letter abbr's with
E,R,P,E,A,K in.
Best Scoring 13 Letter Words With: E,R,P,E,A,K
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| hyperkinesias | 13 | 25 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| speakerphones | 13 | 24 | nounn | |||||
noun • a telephone with a microphone and loudspeaker; can be used without picking up a handset; several people can participate in a call at the same time | ||||||||
| doublespeaker | 13 | 22 | noun, adjectiven, adj | |||||
Valid word for Scrabble US
| ||||||||
| kapellmeister | 13 | 21 | nounn | |||||
noun • A leader or conductor of a musical group such as an orchestra. • A term used during the baroque and classical period for the person in charge of music at a noble court. | ||||||||
| porcelainlike | 13 | 21 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| marlinespikes | 13 | 21 | nounn | |||||
noun • a pointed iron hand tool that is used to separate strands of a rope or cable (as in splicing) | ||||||||
| streptokinase | 13 | 19 | nounn | |||||
noun • an enzyme produced by some strains of streptococcus that can liquefy blood clots by converting plasminogen to plasmin; used medicinally in some cases of myocardial infarction and pulmonary embolism | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 13 Letter Words
Words (18)
kapellmeistershakespeareanstreptokinaseshakespearianporcelainlikespeakerphonesmarlinespikeshyperkinesiasdoublespeakerpremarketingsrealpolitikermuckspreaderskleptocracieskinesitherapysupermarketerprickly-leavedprickly-leafedpeacock-thronePhrases (43)
station keeperpublic speakerpocket plannerpancake turnerpancake batterjack the rippergrass parakeetfrench pancakecharlie parkerwhitebark pinesteak au poivresri lanka rupeespike lavenderspike arresterspeckled alderspeaker systemspark arrestershell parakeetpurple gracklepromenade deckprairie rocketpoker heucheraplumber's snakepeter goldmarkpersonal checkpeppered steakpeacock flowerpancake turtleopen-air marketnative speakerkarl gjellerupiris kaempferigreek alphabetgreat knapweedgerman pancakegenus pereskiaespresso makercroupier's rakecocker spanielchain pickerelcarpenter's kitbeaked parsleyamusement park
